Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Solid+Phase+Extraction


10,014  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
SearchResultCount:"10014"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 1655-52-3 MDL Number: MFCD00038106 Molecular Formula: C9H9N3O6 Molecular Weight: 255.19 Purity/Analysis Method: 98.0% (HPLC,T) Fo...
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 6094-36-6 MDL Number: MFCD00014028 Molecular Formula: C12H13NO5 Molecular Weight: 251.24 Purity/Analysis Method: 98.0% (HPLC,T) F...
MSDS SDS
Supplier:  Anaspec Inc
Description:   Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Molecul...
Supplier:  Thermo Scientific
Description:   These plates consist of 8- or 12-well strips, either solid or breakable, assembled in a frame
Supplier:  Electron Microscopy Sciences
Description:   Plastic boats are utilized to weigh liquid or solid samples.
Minority or Woman-Owned Business Enterprise
Supplier:  Thermo Scientific
Description:   Thermo Scientific Nuncâ„¢ low profile 5.0 ml externally-threaded universal tubes provide a robust solution for solid or liquid sample storage.
Supplier:  Thermo Scientific
Description:   Choose from solid polystyrene plates in a standard 96-well format or polystyrene modules consisting of twelve 8-well strips
Supplier:  Spectrum Chemicals
Description:   Sodium Selenite, 99.8+ Percent, Powder is the most common selenium compound that is soluble in water. It is a solid that has no color and is a salt. I...
MSDS SDS
Small Business Enterprise
Supplier:  Spectrum Chemicals
Description:   Fructose, Granular, USP is a white, odorless crystalline solid that is extremely sweet and is the most water soluble of all sugars.
Small Business Enterprise
Supplier:  Foxx Life Sciences
Description:   Amber borosilicate glass 3.3 bottles, with flat head solid glass stoppers.
Supplier:  Bel-Art Products
Description:   This solid paperboard pouch is 10 mil thick and offers protection against sharp-edged objects prior to and during disposal.
Supplier:  Alfa Aesar
Description:   Starch indicator solution 1%, w/v aqueous solution (for iodometric titrations)
MSDS SDS
Supplier:  Alfa Aesar
Description:   Cobalt, Oil based standard solution, Co 1000ug/g, Grade: Specpure, CAS Number:, molecular formula:, Form: Liquid, Synonyms:, 50g
MSDS SDS
Supplier:  Alfa Aesar
Description:   4% v/v Aqueous Solution.Liquid,WARNING: Irritates skin and eyes,500ml,1L.
MSDS SDS
Supplier:  Alfa Aesar
Description:   Tellurium, plasma standard solution, Te 10ug/ml, Grade: Specpure, Molecular Formula: Te in 2% HNO3, Form: Liquid, Size: 100ML
MSDS SDS
Supplier:  Alfa Aesar
Description:   Phosphorus, AAS standard solution, Specpure|r, P 1000µg/ml
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,753 - 4,768  of 10,014