Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4,4\\\\\\\'-sulfinylbis(methoxybenzene)


40,248  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"40248"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Ward's Science
Description:   Completely safe and realistic for urinalysis.
MSDS SDS
Supplier:  AMBEED, INC
Description:   (R)-3,3'-Bis(2-naphthalenyl)-1,1'-binaphthyl-2,2'-diyl Hydrogen Phosphate, Purity: 98% 99%ee, CAS Number: 791616-56-3, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, 2-8 C, Size: 1g

Supplier:  LGC STANDARDS
Description:   Rosuvastatin Calcium Salt, TRC, LGC Standards
New Product
Supplier:  Bioss
Description:   Calcium channels mediate the influx of calcium ions into the cell following membrane polarisation. R-type calcium channels such as Cav2.3 belong to the "high voltage-activated" group and are blocked by nickel. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Each of these proteins exists as multiple isoforms, either encoded by different genes or arising from alternative splicing of transcripts. Cav2.3 is an alpha-1 subunit and has 24 transmembrane segments, which form the pore through which ions pass into the cell. Calcium channels containing the Cav2.3 subunit may be involved in the modulation of firing patterns of neurons, which is important for information processing.
Catalog Number: (10408-590)

Supplier:  Bioss
Description:   Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).

Supplier:  Boster Biological Technology
Description:   CASR Monoclonal Antibody: Clone: 11E9), Host: Mouse, Reactivity: Human, Conjugate: DyLight* 488, Immunogen: E. Coli-derived CASR recombinant protein (Position: Q926-S1078), Alternative Names: Calcium-sensing R/CaSR, calcium-sensing receptor, Size: 50ug/vial
Supplier:  TCI America
Description:   CAS Number: 13674-87-8
MDL Number: MFCD00083121
Molecular Formula: C9H15Cl6O4P
Molecular Weight: 430.89
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 252
Flash Point (°C): 249
Specific Gravity (20/20): 1.52
MSDS SDS
Catalog Number: (10106-144)

Supplier:  Prosci
Description:   The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Catalog Number: (10349-712)

Supplier:  Bioss
Description:   CACNB2 is a subunit of a voltage-dependent calcium channel protein which is a member of the voltage-gated calcium channel superfamily, expressed in the CNS. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. It was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome which is an autoimmune disorder. Mutations in this gene are associated with Brugada symdrome. Alternatively spliced variants have been identified for this gene.
Catalog Number: (103008-282)

Supplier:  Anaspec Inc
Description:   This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Spectrum Chemicals
Description:   5 Percent Palladium on Calcium Carbonate Powder, Unreduced, Dry, 3 microns, BASF Catalyst
Supplier:  Spectrum Chemicals
Description:   Ammonium Phosphate Dibasic, FCC is a food ingredient used as an acidity regulator and raising agent. It is listed on the FDA's Generally Recognized As Safe (GRAS) list of substances. Spectrum Chemical offers over 300 Food Grade (FCC) chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities

Supplier:  Genetex
Description:   This solution is sufficient to prepare 10 L of 1X phosphate buffered saline
Catalog Number: (77695-109)

Supplier:  LGC STANDARDS
Description:   Sacubitril Calcium, TRC, LGC Standards
New Product
Catalog Number: (10342-862)

Supplier:  Bioss
Description:   Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine (By similarity).
Supplier:  Bachem Americas
Description:   Sequence: 1,2-O-Dihexadecyl-sn-glycero-3-phosphoethanolamine
Synonym(s): L-β,γ-Dihexadecyl-α-cephalin
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,257 - 2,272  of 40,248