SynaptoGreen\u2122+C18+(Equivalent+to+FM®3-25)
Catalog Number:
(76303-878)
Supplier:
PeproTech, Inc.
Description:
VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothellial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase(flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. Recombinant Rat VEGF 165 is a 38.5 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.
Catalog Number:
(89351-766)
Supplier:
Genetex
Description:
VEGFR 1 is a cell membrane receptor kinase. It has a high affinity receptor for vascular endothelial growth factor and is putatively involved in the growth of endothelial cells and angiogenesis.
Supplier:
Tonbo Biosciences
Description:
The BM8.1 antibody is specific for mouse F4/80 antigen, a 125 kDa transmembrane protein widely expressed by members of the mononuclear phagocyte system and considered to be a key marker for mature macrophage cells. F4/80 is differentially expressed during myeloid cell development, and may be regulated by certain cytokines within the tissue microenvironment. Other cell types shown to express this antigen include Langerhans cells, Kupffer cells and dendritic cell subsets. BM8.1 is widely used together with antibodies to CD115 (c-fms), CD11b and CD11c to identify myeloid / macrophage cells by flow cytometry.
Supplier:
Tonbo Biosciences
Description:
The BM8.1 antibody is specific for mouse F4/80 antigen, a 125 kDa transmembrane protein widely expressed by members of the mononuclear phagocyte system and considered to be a key marker for mature macrophage cells. F4/80 is differentially expressed during myeloid cell development, and may be regulated by certain cytokines within the tissue microenvironment. Other cell types shown to express this antigen include Langerhans cells, Kupffer cells and dendritic cell subsets. BM8.1 is widely used together with antibodies to CD115 (c-fms), CD11b and CD11c to identify myeloid / macrophage cells by flow cytometry.
Catalog Number:
(10802-454)
Supplier:
Rockland Immunochemical
Description:
Signals from most growth factors and cytokines are transduced by receptor tyrosine kinases or non-receptor tyrosine kinases. Activated tyrosine kinases phosphorylate their substrates, which mediate the cellular response to extracellular stimuli. A long-sought major substrate termed p62dok (downstream of tyrosine kinase) for many tyrosine kinases including c-kit, v-abl, v-Fps, v-Src, v-Fms, and activated EGF, PDGF, IGF, VEGF and insulin receptors was identified recently from human and mouse by several laboratories. Upon phosphorylation, p62dok forms a complex with the ras GTPase-activating protein (RasGAP). p62dok represents a new family with very recently identified p56dok.
Supplier:
Restek
Description:
Restek’s molecular sieve 5A PLOT columns are designed for efficient separation of argon/oxygen and other permanent gases, including carbon monoxide.
Catalog Number:
(10070-074)
Supplier:
Prosci
Description:
FLT3 encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.
Catalog Number:
(76303-664)
Supplier:
PeproTech, Inc.
Description:
VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. Recombinant Murine VEGF 165 is a 39.0 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.
Catalog Number:
(RLD305)
Supplier:
Rockland Immunochemical
Description:
All lyophilized control sera comes in 5 mL vials.
![]() ![]()
Catalog Number:
(76303-588)
Supplier:
PeproTech, Inc.
Description:
VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. VEGF signals through three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. Due to its increased acidity, VEGF 121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates. Recombinant Human VEGF 121 is a 28.4 kDa, disulfide-linked homodimeric protein consisting of two 121 amino acid polypeptide chains.
Catalog Number:
(10751-004)
Supplier:
Prosci
Description:
FREM1 Antibody: FREM1 is a member of the FRAS1-related extracellular matrix protein family and is thought to play a role in craniofacial and renal development. FREM1 functions as an extracellular matrix protein that is essential for epidermal adhesion during embryogenesis and may also participate in epidermal differentiation. It is recognized by cells in the embryonic skin and hair follicles through different members of the integrin family. Deficiency in the Fras1/Frem genes gives rise to the bleb phenotype, which is equivalent to the human hereditary disorder Fraser syndrome.
Catalog Number:
(77129-916)
Supplier:
Prosci
Description:
Native Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ Amino acids S1 – Q306 (end). Residue S237 of the fusion protein is equivalent to S1 of the native enzyme. The GST tag is located at residues 1 – 220 and the His6 tag is located at residues 545– 550. Has C-terminal 5’ residues of NSP4 (residues 232 – 236) between PreScission site and N-terminus of NSP5 – corresponding to the cleavage site between NSP4 and NSP5 in the polyprotein of the SARS CoV virus to generate an authentic N-terminus during gene expression. The C-terminus encodes for a modified PreScission cleavage site before the His6 tag to generate an authentic C-terminus when cleaved, SGVTFQGP, residues 537 - 544. Protease Cleavage: Modified PreScission - SGVTFQGP, residues 537 - 544
Supplier:
Adipogen
Description:
Convenient substitute of o-iodoxybenzoic acid (IBX) as an oxidant. FIBX is safer, has neutral properties behaves as an equivalent to IBX in the oxidation of alcohols to ketones or aldehydes in polar solvents and shows better solubility.
Catalog Number:
(10468-766)
Supplier:
Bioss
Description:
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses).
Supplier:
Enzo Life Sciences
Description:
The Hsp70 family of heat shock protiens contains multiple homologs ranging in size from 66-78 kDa, and are the eukaryotic equivalents of the bacterial DnaK. The most studied Hsp70 members include the cytosolic stress-induced Hsp70 (Hsp72), the constitutive cytosolic Hsc70 (Hsp73), and the ER-localized BiP (Grp78). Hsp70 family members contain highly conserved N-terminal ATP-ase and C-terminal protein binding domains. Binding of peptide to Hsp70 is assisted by Hsp40, and stimulates the inherent ATPase activity of Hsp70, facilitating ATP hydrolysis and enhanced peptide binding. Hsp70 nucleotide exchange and substrate binding coordinates the folding of newly synthesized proteins, the re-folding of misfolded or denatured proteins, coordinates trafficking of proteins across cellular membranes, inhibits protein aggregation, and targets the degradation of proteins via the proteasomal pathway.
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Hexane (mixture of isomers) for analysis
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||