Text Search >
Fmoc-4-amino-D-phenylalanine
Print…
You Searched For:
127,908 results were found
Fmoc-4-amino-D-phenylalanine
Supplier:
G-Biosciences
Description:
Many lysis buffers and reagents used in sample preparation are incompatible with routinely used electrophoretic analysis
Catalog Number:
(77293-978)
Supplier:
AMBEED, INC
Description:
4-Nitrophenyl phosphate disodium salt hexahydrate (pNPP) 98%
Catalog Number:
(TS44786-0010)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Calcium acetate xhydrate 99% for analysis
Supplier:
BeanTown Chemical
Description:
CAS: 813-93-4; EC No: 212-390-1; MDL No: MFCD00050817
Powder, typically 10 micron max ; Molecular Formula: C6H5BiO7; MW: 398.08
Melting Point: 300° (decomposes)
Density (g/mL): 0.94
Light Sensitive
Catalog Number:
(95017-776)
Supplier:
GE Healthcare - Life Sciences
Description:
The 2-D Clean-Up Kit is designed to prepare samples for 2-D electrophoresis that otherwise produce poor 2-D spot-maps due to high conductivity, high levels of interfering substances, or low protein concentration. The reagents quantitatively precipitate proteins while leaving interfering substances, such as detergents, salts, lipids, phenolics, and nucleic acids, in solution.
Supplier:
Strem Chemicals Inc
Description:
CAS #: 19513-05-4. Size: 5g.
Supplier:
Thermo Scientific Chemicals
Description:
Potassium dihydrogen citrate hydrate is used as a buffering agent and a chelating agent. It is used as an alkalizing agent in the renal function. It is found that it increases the bone density, thereby used in research experiments related to the treatment of osteoporosis.
Catalog Number:
(101410-790)
Supplier:
Electron Microscopy Sciences
Description:
Silver Nitrate solution is available in concentrations of 1.0% aqueous, 2.0% aqueous, 5.0% aqueous, 10.0% aqueous, and 20.0% aqueous.
Catalog Number:
(EM1.07241.1000)
Supplier:
MilliporeSigma
Supplier:
Spectrum Chemicals
Description:
ZINC STEARATE, POWDER, USP is also referred to as 'Zinc Soap' and can be used in powders and ointments in the treatment of eczema, acne, and other skin diseases. It may also be used as a lubricant in cosmetic formulations to improve texture and smoothness. Zinc stearate has antiseptic, astringent and topical protective properties. Spectrum Chemical manufactured USP products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Supplier:
MP Biomedicals
Description:
MES is a zwitterionic buffer. One of the "Good" buffers developed for biological applications. It has the advantages of maximum water solubility and minimum solubility in all other solvents, minimal salt effects, minimal change in pK with temperature, chemically and enzymatically stable, minimal absorption in visible or UV spectral range.
A buffer using MES free acid can be prepared by titrating the free acid with sodium hydroxide to the desired pH (pKa ± 1). Alternatively, volumes of equimolar MES free acid and sodium or potassium MES can be mixed to attain the desired pH.
Catalog Number:
(TCP0659-025G)
Supplier:
TCI America
Description:
[Guaranteed for Standard to GOT, GPT]
CAS Number: 2922-61-4 MDL Number: MFCD00036136 Molecular Formula: C3H4O3 Molecular Weight: 93.99 Purity/Analysis Method: >95.0% (T) Form: Crystal Storage Temperature: 0-10°C
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(76180-658)
Supplier:
MP Biomedicals
Description:
TBE buffer is a solution of 1M Tris, 0.9M boric acid and 0.01M EDTA disodium salt, prepared from MP's Ultra Pure products.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
