Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Methyl+2-bromo-4-(bromomethyl)benzoate


40,282  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"40282"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Rockland Immunochemical
Description:   Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Bioss
Description:   This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [FUNCTION] Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Catalog Number: (103010-986)

Supplier:  Anaspec Inc
Description:   Tetramethylrhodamine iodoacetamides (TMRIA) are thiol-selective reactive dyes that are used to label proteins via the cysteine residues. 5-TMRIA, the pure 5-isomer of TMRIA, is increasingly preferred for some particular applications since the mixed isomers of TMRIA may give different results from batch to batch due to the varying ratios and different reactivities of the two isomers. For example, 5-TAMRA is reported to predominantly label SH-1 (Cys-707) of the myosin heavy chain in skinned muscle fibers.
Catalog Number: (H-9025.0500BA)

Supplier:  Bachem Americas
Description:   Endothelins are peptides with exceptional vasoconstrictor potency. They play an important role in intercellular communications.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human IFNω (NP_002168.1) (Cys 24-Ser 195) was fused with the Fc region of human IgG1 at the N-terminus.
Supplier:  Biotium
Description:   bcl-2, Monoclonal antibody,Clone: 100/D5 + 124, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF640R, Immunogen: A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG-Cys) of human Bcl-2 (100/D5 & 124), Synonyms: lymphoma-2, Size: 100 ul
Supplier:  Thermo Scientific Chemicals
Description:   An inhibitor of DMBA-induced mammary tumors.
MSDS SDS

Supplier:  GE Healthcare - Life Sciences
Description:   ECL Plex Cy-conjugated Antibodies are part of an optimized system for quantitative analysis using fluorescent western blotting.
MSDS SDS
Supplier:  Sino Biological
Description:   A DNA sequence encoding the rat IL3 (NP_113701.1) (Met 1-Cys 169) was fused with a polyhistidine tag at the C-terminus.

Supplier:  Sino Biological
Description:   A DNA sequence encoding the human PCBP1 (NP_006187.2) (Asp 2-Cys 356) was expressed, with a polyhistidine tag at the N-terminus.
Supplier:  Enzo Life Sciences
Description:   The mammalian protein disulphide-isomerase (PDI) family encompasses several highly divergent proteins involved in the processing and maturation of secretory proteins in the ER by catalyzing the rearrangement of disulphide bonds. PDI, an abundant protein of the ER (>400uM), contains a carboxy-terminal retention signal sequence, KDEL, similar to that of BiP and Grp94. The PDI proteins are characterized by the presence of one or more domains of ~95-110 amino acids related to the cytoplasmic protein thioredoxin. All but the PDI-D subfamily are composed entirely of repeats of such domains, with at least one domain containing - and one domain lacking - a redox-active-Cys-X-X-Cys-tetrapeptide. In addition to roles as redox catalysts and isomerases, PDI proteins perform such functions as peptide binding and cell adhesion, and may conduct chaperone activities. Platelet surface thiols and disulphides play an important role in platelet responses. Catalytically active PDI resides on platelet surfaces where it mediates platelet aggregation and secretion by reducing disulfide bonds, thus exposing fibrinogen receptors in platelets.
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041827-1G , MDL Number: MFCD01862946
Supplier:  Biotium
Description:   Bax Monoclonal antibody, Clone: 2D2, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, Conjugate: purified, Immunogen: A synthetic peptide, aa 3-16 (Cys-GSGEQPRGGGPTSS) of human bax protein, Application: IF, Immunohistology, Western, FC, Size: 100uL
Supplier:  AMBEED, INC
Description:   Boc-(S)-3-amino-4-(4-trifluoromethylphenyl)butyric acid ≥98%
Supplier:  Bioss
Description:   This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [FUNCTION] Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
273 - 288  of 40,282