Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Uridine-5\'-triphosphoric+acid+trisodium+salt+(UTP-Na3)


147,756  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"147756"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Ferrous oxalate dihydrate, Purity: 99+%, CAS Number: 6047-25-2, Appearance: Yellow to Orange powder, Storage: Sealed in dry, Room Temperature, Size: 100g
Supplier:  AMBEED, INC
Description:   Manganese acetate tetrahydrate, Purity: 99+%, CAS Number: 6156-78-1, Appearance: Form: solid Colour: light pink to red, Storage: Sealed in dry, Room Temperature, Size: 10G
Supplier:  Rigaku Reagents
Description:   Use our stock solutions directly or as a component in solutions you create in your own lab. We prepare our stock solutions using high quality raw materials, ASTM Type 1 water, and sterile packaging. Our stock solutions are intended for Research and Development Use Only.
Supplier:  BeanTown Chemical
Description:   CAS: 6156-78-1; EC No: 211-334-3; MDL No: MFCD00062552 Crystalline; Linear Formula: (CH3COO)2Mn·4H2O; MW: 245.09 Melting Point: <gt/>300° Density (g/mL): 1.589
MSDS SDS
Supplier:  AMBEED, INC
Description:   Iron(III) Stearate, Purity: 98%, CAS Number: 555-36-2, Appearance: Pale yellow to yellow-red powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 100G
Catalog Number: (100504-058)

Supplier:  Electron Microscopy Sciences
Description:   Shunway's stain for animal embryos. Used with Acid Fuchsin for staining Negri bodies (Stain Tech., 5, 34 (1928)) and counterstain to hematoxylin for staining vaginal smears (Am. J. Anat., 61, 505 (1937)).
Minority or Woman-Owned Business Enterprise
Catalog Number: (103531-012)

Supplier:  Acros Organics
Description:   Aluminium nitrate nonahydrate, ACS reagent, CAS No 7784-27-2, MF Al N3 O9. 9 H2 O, Color Colorless to white, Form Crystalline powder or crystals, Synonyms: Nitric acid, aluminum salt, nonahydrate.; Aluminum trinitrate nonahydrate, Size: 2.5kg
Catalog Number: (103007-216)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  BeanTown Chemical
Description:   CAS: 85144-11-2; EC No: 231-212-3; MDL No: MFCD00149764 Crystalline Aggregates; Linear Formula: LiCl·xH2O; MW: 42.39 (anhydrous) Hygroscopic
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   98% 250G
MSDS SDS
Catalog Number: (101443-742)

Supplier:  Rigaku Reagents
Description:   Use our stock solutions directly or as a component in solutions you create in your own lab. We prepare our stock solutions using high quality raw materials, ASTM Type 1 water, and sterile packaging. Our stock solutions are intended for Research and Development Use Only.
Catalog Number: (101410-816)

Supplier:  Electron Microscopy Sciences
Description:   Sodium Thiosulfate solution Electron Microscopy Sciences is available in concentrations of 1.0% aqueous, 2.0% aqueous, and 10.0% aqueous.
Minority or Woman-Owned Business Enterprise
Supplier:  Rigaku Reagents
Description:   Use our stock solutions directly or as a component in solutions you create in your own lab. We prepare our stock solutions using high quality raw materials, ASTM Type 1 water, and sterile packaging. Our stock solutions are intended for Research and Development Use Only.
Catalog Number: (101443-782)

Supplier:  Rigaku Reagents
Description:   Use our stock solutions directly or as a component in solutions you create in your own lab. We prepare our stock solutions using high quality raw materials, ASTM Type 1 water, and sterile packaging. Our stock solutions are intended for Research and Development Use Only.
Supplier:  Spectrum Chemicals
Description:   Sodium Acetate, Trihydrate, Granular, FCC is used as food flavorant. The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Supplier:  AMBEED, INC
Description:   Sodium 3-((-ethyl(-4-((4-(ethyl(3-sulfonatobenzyl)amino)phenyl)(4-sulfonatophenyl)methylene)cyclohexa-2,5-dien-1-ylidene)ammonio)methyl)benzenesulfonate, Purity: 97%, CAS Number: 5141-20-8, Red to Dark red to Dark purple powder to crystal, Storage: Inert atmosphere, Room Temperature, Size: 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,401 - 4,416  of 147,756