Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Uridine-5\\\\\\\\\\\\\\\'-triphosphoric+acid+trisodium+salt+(UTP-


147,782  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
Your search request has been modified to limit number of results. Your search was -
Uridine-5\\\\\\\\\\\\\\\'-triphosphoric+acid+trisodium+salt+(UTP-Na3)
 
 
SearchResultCount:"147782"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Ricca Chemical
MSDS SDS
Small Business Enterprise
Supplier:  Honeywell Research Chemicals
Description:   Magnesium sulfate Drying agent, Purity: >/=98.0%, Grade: ACS, CAS Number: 7487-88-9, Molecular formula: MgSO4, Molar mass: 120.37 g/mol, Container Type: Poly bottle, Appearance: White, Application: Laboratory Chemical, Size: 250G
Supplier:  Thermo Scientific Chemicals
Description:   Aluminum silicate is used to prepare aluminum-silicate polymer composite (PASiC), which is an inorganic coagulant used in water treatment. It is used as a catalyst for the pyrolysis of rice husk to crude bio -oil, which upgraded to supercritical ethanol. Further, it is used as filler in paper, rubber and in paints.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00149569 Beilstein Registry No.: 3731397 Fieser: 18,106 20,115
MSDS SDS
Supplier:  Ricca Chemical
Small Business Enterprise
Supplier:  BeanTown Chemical
Description:   CAS: 6046-93-1; EC No: 205-553-3; MDL No: MFCD00149570; RTECS: AG3500000 UN No: UN3077; Haz Class: 9; Packing Group: III Powder; Linear Formula: Cu(OOCCH3)2·H2O; MW: 199.65 Melting Point: 115° Density (g/mL): 1.882
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 6047-25-2; EC No: 208-217-4; MDL No: MFCD00150040 Powder; Linear Formula: FeC2O4·2H2O; MW: 179.90 Density (g/mL): 2.28 Hygroscopic
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 7487-88-9; EC No: 231-298-2; MDL No: MFCD00011110; RTECS: OM4500000 Powder; Linear Formula: MgSO4; MW: 120.37 Melting Point: 1124° (decomposes) Density (g/mL): 1.07 Hygroscopic
MSDS SDS

Supplier:  Ricca Chemical
MSDS SDS
Small Business Enterprise
Supplier:  Ricca Chemical
MSDS SDS
Small Business Enterprise

Supplier:  Electron Microscopy Sciences
Description:   Aqueous Solutions
Minority or Woman-Owned Business Enterprise
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00066973 Beilstein Registry No.: 3730764 Fieser: 20,254
MSDS SDS
Supplier:  MilliporeSigma
MSDS SDS
Supplier:  GE Healthcare - HyClone
Description:   Supplements cell culture with amino acids, vitamins, salts, trace elements, and glucose. Manufactured to meet cGMP manufacturing standards and QC specifications.
MSDS SDS
Supplier:  Strem Chemicals Inc
Description:   CAS #: 6147-53-1. Size: 500g.
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,529 - 4,544  of 147,782