Uridine-5\\\\\\\\\\\\\\\'-triphosphoric+acid+trisodium+salt+(UTP-
Your search request has been modified to limit number of results. Your search was - Uridine-5\\\\\\\\\\\\\\\'-triphosphoric+acid+trisodium+salt+(UTP-Na3) |
|||||||||
Supplier:
Honeywell Research Chemicals
Description:
Magnesium sulfate Drying agent, Purity: >/=98.0%, Grade: ACS, CAS Number: 7487-88-9, Molecular formula: MgSO4, Molar mass: 120.37 g/mol, Container Type: Poly bottle, Appearance: White, Application: Laboratory Chemical, Size: 250G
Supplier:
Thermo Scientific Chemicals
Description:
Aluminum silicate is used to prepare aluminum-silicate polymer composite (PASiC), which is an inorganic coagulant used in water treatment. It is used as a catalyst for the pyrolysis of rice husk to crude bio -oil, which upgraded to supercritical ethanol. Further, it is used as filler in paper, rubber and in paints.
Supplier:
Thermo Scientific Chemicals
Description:
MDL: MFCD00149569
Beilstein Registry No.: 3731397
Fieser: 18,106 20,115
Supplier:
BeanTown Chemical
Description:
CAS: 6046-93-1; EC No: 205-553-3; MDL No: MFCD00149570; RTECS: AG3500000
UN No: UN3077; Haz Class: 9; Packing Group: III
Powder; Linear Formula: Cu(OOCCH3)2·H2O; MW: 199.65
Melting Point: 115°
Density (g/mL): 1.882
Supplier:
BeanTown Chemical
Description:
CAS: 6047-25-2; EC No: 208-217-4; MDL No: MFCD00150040
Powder; Linear Formula: FeC2O4·2H2O; MW: 179.90
Density (g/mL): 2.28
Hygroscopic
Supplier:
BeanTown Chemical
Description:
CAS: 7487-88-9; EC No: 231-298-2; MDL No: MFCD00011110; RTECS: OM4500000
Powder; Linear Formula: MgSO4; MW: 120.37
Melting Point: 1124° (decomposes)
Density (g/mL): 1.07
Hygroscopic
Catalog Number:
(RC6400-16)
![]()
Catalog Number:
(101410-780)
Supplier:
Electron Microscopy Sciences
Description:
Aqueous Solutions
![]()
Supplier:
Thermo Scientific Chemicals
Description:
MDL: MFCD00066973
Beilstein Registry No.: 3730764
Fieser: 20,254
Supplier:
GE Healthcare - HyClone
Description:
Supplements cell culture with amino acids, vitamins, salts, trace elements, and glucose. Manufactured to meet cGMP manufacturing standards and QC specifications.
Supplier:
Strem Chemicals Inc
Description:
CAS #: 6147-53-1. Size: 500g.
Catalog Number:
(103007-214)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV Molecular Weight: 4328.9 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||