Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Uridine-5\\\\\\\\\\\\\\\'-triphosphoric+acid+trisodium+salt+(UTP-


146,991  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
Your search request has been modified to limit number of results. Your search was -
Uridine-5\\\\\\\\\\\\\\\'-triphosphoric+acid+trisodium+salt+(UTP-Na3)
 
 
SearchResultCount:"146991"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  MilliporeSigma
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 4468-02-4
MDL Number: MFCD04037230
Molecular Formula: C6H12O7
Molecular Weight: 455.67
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Specific rotation [a]20/D: 10 deg (C=1, H2O)
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 7487-88-9; EC No: 231-298-2; MDL No: MFCD00011110; RTECS: OM4500000 Powder; Linear Formula: MgSO4; MW: 120.37 Melting Point: 1124° (decomposes) Density (g/mL): 1.07 Hygroscopic
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 6046-93-1; EC No: 205-553-3; MDL No: MFCD00149570; RTECS: AG3500000 UN No: UN3077; Haz Class: 9; Packing Group: III -4 Mesh Powder; Linear Formula: Cu(OOCCH3)2·H2O; MW: 199.65 Melting Point: 115° Density (g/mL): 1.882
MSDS SDS
Supplier:  Ricca Chemical
MSDS SDS
Small Business Enterprise
Supplier:  MP Biomedicals
Description:   Tris have been useful as buffers in a wide variety of biological systems. It has been used as a starting material for polymers, oxazolones (with carboxylic acids) and oxazolidines (with aldehydes). It does not precipitate calcium salts and is of value in maintaining solubility of manganese salts. It can be used for the direct standardization of a strong acid solution; the equivalence point can be determined either potentiometrically or by use of a suitable indicator such as 3-(4-Dimethylamino-1-naphthylazo)-4-methoxybenzenesulfonic acid. It is RNAse and DNAse-free. Tris is relatively non-hygroscopic ; but, if needed, it can be dried at 100 °C for up to 4 hours to remove any water.
Tris is used in pH control in vitro and in vivo for body fluids and in buffering systems for electrophoresis applications.Tris is used in assays used to characterize the activity and kinetics of the enzymes that catalyze SUMOylation of Small ubiquitin-like proteins (SUMO) and SUMO-dependent protein-protein interactions.
MSDS SDS
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   Standardized at 25 °C against chemicals whose certification is traceable to NIST. Lot standardization value, accurate to ±1 part per 1000, provided on label.
Supplier:  Thermo Scientific Chemicals
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 563-72-4; EC No: 209-260-1; MDL No: MFCD00012474 UN No: UN3288; Haz Class: 6.1; Packing Group: III Powder; Linear Formula: CaC2O4; MW: 128.10 Density (g/mL): 2.2 Hygroscopic
MSDS SDS
Catalog Number: (10751-312)

Supplier:  Prosci
Description:   SIK1 Antibody: Salt-inducible kinase 1 (SIK1), also known as SNF1LK or MSK, plays a role in histone modification and G2/M cell cycle regulation. It is a 783 amino acid protein that contains one UBA domain and belongs to the Ser/Thr protein kinase family (AMPK subfamily). Localized to both the nucleus and the cytoplasm, SIK1 is a class II HDAC kinase that uses magnesium as a cofactor to catalyze the ATP-dependent phosphorylation of target proteins and is thought to be important for the early stages of skeletal muscle growth and myocardial cell differentiation.
Supplier:  MilliporeSigma
Description:   (pNPP, sodium). Pale yellow solid. Contaminants: free p-nitrophenol: <0.1%. CAS 4264-83-9, M.W. 263.1.
MSDS SDS
Supplier:  MP Biomedicals
Description:   Boric acid is used for weatherproofing wood and fireproofing fabrics; as a preservative; manufacturing of cements, crockery, porcelain, enamels, glass, borates, leather, carpets, hats, soaps, artificial gems; in nickeling baths; cosmetics; printing and dyeing, painting; photography; for impregnating wicks; electric condensers; hardening steel. It is also used as an insecticide for cockroaches and black carpet beetles. It is used In the research labs , astringent, antiseptic, antibacterial and antifungal agent. It is used in buffers and for calibration of polyacrylamide gel columns for the separation of oligonucleotides by capillary electrophoresis.
Supplier:  GE Healthcare - HyClone
Description:   Supplements cell culture with amino acids, vitamins, salts, trace elements, and glucose. Manufactured to meet cGMP manufacturing standards and QC specifications.
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 6156-78-1; EC No: 211-334-3; MDL No: MFCD00062552; RTECS: AI5775000 Crystalline; Linear Formula: (CH3COO)2Mn·4H2O; Molecular Formula: C4H6MnO4·4H2O; MW: 245.09 Melting Point: <gt/>300° Density (g/mL): 1.589
MSDS SDS
Supplier:  AMBEED, INC
Description:   Manganese(II) acetate, Purity: 98% (Loss on drying less than or equal to 30%), CAS Number: 638-38-0, Appearance: Pale Pink to Red Powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 100G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,529 - 4,544  of 146,991