Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+isothiocyanatoformate


32,680  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"32680"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (76483-850)

Supplier:  AAT BIOQUEST INC
Description:   A 'half-molecule' of Chrysamine G, the well-known marker for beta-amyloid deposition, offers protection against beta-amyloid 25-35 and beta-amyloid 40-induced neuronal death at a concentration of 0.1 to 1 µM.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Foxx Life Sciences
Description:   Imapex™ Peroxide Grade silicone tubing is designed for non-critical fluid transfer, peristaltic pump use, and general engineering applications.
Supplier:  MilliporeSigma
Catalog Number: (TCT2426-25G)

Supplier:  TCI America
Description:   CAS Number: 1070-78-6 MDL Number: MFCD00054655 Molecular Formula: C3H4Cl4 Molecular Weight: 181.87 Purity/Analysis Method: <gt/>98.0% (GC) Form: Clear Liquid Color: Colorless Boiling point (°C): 159 Melting point (°C): -35 Specific Gravity (20/20): 1.47
MSDS SDS
Supplier:  Thermco
Description:   These high precision liquid-in-glass mercury thermometers are hand blown, which bear graduations, numbers and letters etched into the glass and filled with and inert gas above the mercury column
MSDS SDS

Supplier:  W.R. GRACE & CO. - CONN
Description:   Proven performance and high quality chromatographic silica.
Supplier:  Wilmad-LabGlass
Description:   These borosilicate glass gas washing bottles are generally used to saturate or dry gas streams.
Catalog Number: (89007-840)

Supplier:  Brady Worldwide
Description:   Versatile sign posts for permanent or temporary use

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  AAT BIOQUEST INC
Description:   Luciferin is the most popular and versatile bioluminescent substrate.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  SPEX
Description:   The Cole-Parmer® XP-400 X-Press® hydraulic laboratory pellet press is an automatic and fully programmable pellet press designed for repetitive pressing of sample pellets for XRF, IR, and other analytical techniques. This press can also be operated manually as a simple motorized press whose functions are under direct user control.
Supplier:  Bel-Art Products
Description:   Open, nickel plated brass armor protects thermometer from accidental breakage during use and storage.
Supplier:  TCI America
Description:   CAS Number: 2374-05-2
MDL Number: MFCD00002314
Molecular Formula: C8H9BrO
Molecular Weight: 201.06
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 79
MSDS SDS
Supplier:  HETTICH INSTRUMENTS
Description:   Angle Rotor, 6 place, Maximum Tube capacity: 50ml, Angle: 35 deg, Maximum RCF: 4,025, Run up: 14 sec, Run down: 17 sec, Temperature: -20 deg C, For Mikro 220 / 220R Microlitre centrifuges
Product available on GSA Advantage®
Supplier:  AMBEED, INC
Description:   2-Hydroxy-2-(4-(trifluoromethyl)phenyl)acetic acid, Purity: 98%, CAS Number: 395-35-7, Appearance: Form: solid, Storage: Sealed in dry, Room Temperature, Size: 1g
Supplier:  AOB CHEM USA
Description:   5-(3-Ethoxy-4-fluorophenyl)thiazol-2-amine ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
33 - 48  of 32,680