Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"20994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AFG BIOSCIENCE LLC
Description:   Human CGb (Chorionic Gonadotropin Beta Polypeptide) ELISA Kit
Supplier:  Novus Biologicals
Description:   The beta 2-Microglobulin Antibody (B2M / 1118) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate. The beta 2-Microglobulin Antibody (B2M / 1118) [DyLight 550] has been validated for the following applications: Flow Cytometry, Immunohistochemistry-Paraffin.
Catalog Number: (76744-024)

Supplier:  ANTIBODIES.COM LLC
Description:   Rat Insulin Receptor beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of rat Insulin Receptor beta in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:  Novus Biologicals
Description:   The ARNT / HIF-1 beta Antibody (H1beta234) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to ARNT / HIF-1 beta. This antibody reacts with human, mouse, rat, bovine, ferret, primate, sheep. The ARNT / HIF-1 beta Antibody (H1beta234) [DyLight 550] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (89348-930)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta Catenin (catenin (cadherin-associated protein), beta 1, 88kDa)
Supplier:  Enzo Life Sciences

Supplier:  Novus Biologicals
Description:   The IFN-alpha / beta R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFN-alpha / beta R1. This antibody reacts with human. The IFN-alpha / beta R1 Antibody has been validated for the following applications: Western Blot, Immunoprecipitation.
Supplier:  AMBEED, INC
Description:   Fmoc-ß-HoGlu(OtBu)-OH, Purity: 98+%, CAS number: 203854-49-3, Appearance: Solid, Storage: Sealed in dry, 2-8C, Size: 250MG

Supplier:  ANTIBODIES.COM LLC
Description:   Human Dopamine beta Hydroxylase ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Dopamine beta Hydroxylase in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:  Biotium
Description:   HCG-beta, Monoclonal antibody, Clone: HCGb/54+ HCGb/459, Host: Mouse, Species reactivity: Human, Isotype: IgG's, BSA-free, Immunogen: Recombinant hCG beta protein (HCGb/54 and HCGb/459), Synonyms: CG-beta; CGB3; CGB5; CGB7; CGB8, Application: Immunohistochemistry, Size: 50 uL
Supplier:  Novus Biologicals
Description:   The PI 3-Kinase p110 beta / PIK3CB Antibody (10D5) from Novus Biologicals is a mouse monoclonal antibody to PI 3-Kinase p110 beta / PIK3CB. This antibody reacts with human. The PI 3-Kinase p110 beta / PIK3CB Antibody (10D5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence, Proximity Ligation Assay.
Supplier:  Biotium
Description:   HCG-beta, Monoclonal antibody, Clone: HCGb/54+ HCGb/459, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF488A, Immunogen: Recombinant hCG beta protein (HCGb/54 and HCGb/459), Synonyms: CG-beta; CGB3; CGB5; CGB7; CGB8, Application: IHC, Size: 500uL
Catalog Number: (RL000-001-L07)

Supplier:  Rockland Immunochemical
Description:   Beta Amyloid Control Peptide
Catalog Number: (103229-734)

Supplier:  Novus Biologicals
Description:   Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Polyclonal Antibody, Host: sheep, Species reactivity: Human, Mouse, Isotype: IgG, synonyms: i-beta-1,3-N-acetylglucosaminyltransferase, Application: WB, Size: 100UG
Supplier:  Anaspec Inc
Description:   Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Novus Biologicals
Description:   The PKA regulatory subunit I beta Antibody from Novus Biologicals is a mouse polyclonal antibody to PKA regulatory subunit I beta. This antibody reacts with human. The PKA regulatory subunit I beta Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,185 - 3,200  of 20,994