4-Bromo-1-isopropoxy-2-methoxybenzene
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042440-1G , MDL Number: MFCD02094111
Supplier:
Thermo Scientific Chemicals
Description:
5g CAS: 37736-82-6, MDL: MFCD00211335
Supplier:
TCI America
Description:
Tianeptine Sodium Salt Hydrate, Purity: >98.0%(HPLC)(N), Cas number: 30123-17-2, MF: C21H24ClN2NaO4S.xH2O, MW: 458.93, Synonyms: 7-[[3-Chloro-6,11-dihydro-6-methyldibenzo[c,f][1,2]thiazepin-11-yl]amino]heptanoic Acid S,S-Dioxide Sodium Salt Hydrate, Size: 1G
Catalog Number:
(103003-050)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Catalog Number:
(EM8.14986.0050)
Catalog Number:
(103003-048)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Catalog Number:
(10257-530)
Supplier:
Bioss
Description:
Semaphorins are a family of cell surface and secreted proteins that are conserved from insects to humans. Members of this family of proteins are approximately 750 amino acids in length (including signal sequences) and are defined by a conserved extracellular “semaphorin†domain of approximately 500 amino acids containing 14-16 cysteines, blocks of conserved sequences and no obvious repeats. The transmembrane semaphorins are characterized by an additional 80 amino acid transmembrane domain and an 80-110 amino acid cytoplasmic domain. Secreted and cell-bound semaphorins chemically attract and repel the growth of neural axons, guiding the development of intricate networks of neural tissue. SEMA4B (semaphorin-4B), also known as SemC or SEMAC, is an 832 amino acid single-pass type I membrane protein that belongs to the semaphorin family and exists as two alternatively spliced isoforms. Containing one Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a single sema domain, SEMA4B is encoded by a gene located on human chromosome 15.
Catalog Number:
(TS25430-0010)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
D-(-)-Cysteine 99%
Catalog Number:
(TCL0141-001G)
Supplier:
TCI America
Description:
[as an indicator for assay of Food Yellow No.4 (Tartrazine)]
CAS Number: 5141-20-8 MDL Number: MFCD00012121 Molecular Formula: C37H36N2O9S3 Molecular Weight: 792.84 Form: Crystal Color: Red
Supplier:
BeanTown Chemical
Description:
CAS: 74-79-3; EC No: 200-811-1; MDL No: MFCD00002635; RTECS: CF1934200
Crystalline/Powder; Molecular Formula: C6H14N4O2; MW: 174.20
Melting Point: 222° (decomposes)
Air Sensitive
Catalog Number:
(75790-172)
Supplier:
Prosci
Description:
Clusterin-Like Protein 1 (CLUL1) is a secreted protein that belongs to the clusterin family. CLUL1 is synthesized as a 466 amino acid precursor that contains a 20 amino acid signal sequence, and a 446 amino acid mature chain. CLUL1 is expressed predominantly by cone photoreceptors of the retina. It has been shown that CLUL1 expression is down-regulated in some forms of retinal disease.
Supplier:
Spectrum Chemicals
Description:
(1,2-Cyclohexylenedinitrilo)tetraacetic Acid, Reagent is an alkyl-substituted amino acid that functions as a chelating agent. This ingredient's source is synthetic. It appears as a solid and is partially soluble in cold water. Its reagent grade means this is the highest quality commercially available for this chemical and that the American Chemical Society has not officially set any specifications for this material.
![]()
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-Arg(Tos)-OH
Catalog Number:
(76116-114)
Supplier:
Bioss
Description:
AARE (Acylamino-acid-releasing enzyme) is also known as Acyl-peptide hydrolase. It catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus corresponding to the protein are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
Catalog Number:
(101410-880)
Supplier:
Electron Microscopy Sciences
Description:
Aniline Blue Electron Microscopy Sciences solution is a prepared, ready-to-use, high quality staining solutions for standard staining procedures used by the Biological Staining Commission and the Armed Forces Institute of Pathology. Available in concentrations of 2.5% in 2% Acetic Acid, Phosphomolybdic Acid Solution, and with Orange G.
![]()
Supplier:
AMBEED, INC
Description:
Cephalexin monohydrate ≥98%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||