Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-Formylphenylboronic+acid


19,966  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"19966"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (BJ383082-500G)

Supplier:  Honeywell Research Chemicals
Description:   Cadmium sulfate, Purity: min 99.0%, Grade: ACS Reagent, CAS Number: 10124-36-4, Molecular Formula: CdSO4, Formula Weight: 208.46, Laboratory Chemical, form: Powder, Size: 500G
MSDS SDS
Supplier:  Matrix Scientific
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 035994-500MG , MDL Number: MFCD02255632
Catalog Number: (103003-044)

Supplier:  Anaspec Inc
Description:   Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
Molecular Weight: 4017.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  TCI America
Description:   CAS Number: 82941-26-2
MDL Number: MFCD01105178
Molecular Formula: C8H16O4
Molecular Weight: 176.21
Purity/Analysis Method: >98.0% (GC,T)
Form: Clear Liquid
Boiling point (°C): 141
Specific Gravity (20/20): 1.05
MSDS SDS
Supplier:  Elkay Plastics
Description:   Elkay has a full range of DME equipment covers available for all types of accreditation purposes
Supplier:  TCI America
Description:   CAS Number: 3387-36-8
MDL Number: MFCD00006525
Molecular Formula: C9H13N2O9P
Molecular Weight: 368.15
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Specific rotation [a]20/D: -14 deg (C=1, H2O)
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  Spectrum Chemicals
Description:   Methyl-beta-cyclodextrin, also known as Cyclodextrins, can form complexes with hydrophobic compounds with use in the food and pharmaceutical industries as a solubilizer, stabilizer, emulsifier and odor reducing agent.
Small Business Enterprise
Supplier:  Labconco
Description:   Hooded Combination Kjeldahl Digestion/Distillation Apparatus
Product available on GSA Advantage®
Supplier:  VWR International
Description:   BDH* Ethyl Ether Anhydrous, Chemical Formula: (C2H5)2O, Melting Point: -116.3, Boiling Point: 34.5, Flash Point: -45 deg C, Formula Weight: 74.12, CAS Number: 60-29-7, Grade: HPLC/Spectro, HiPerSolv CHROMANORM, Class: F, Size: 4L
MSDS SDS

Supplier:  Ace Glass
Description:   All working parts and indicia are visible, meter readings are unobstructed; the outlet swivels 360°
Small Business Enterprise
Supplier:  Vetequip
Description:   Accessories for Downdraft Anesthesia Workstations, VetEquip
Supplier:  VWR International
Description:   For use in determining proof ethyl alcohol spirits.
Supplier:  Biolegend
Description:   Purified Mouse IgE, κ Isotype Ctrl [MEA-36]; Isotype: Mouse (BALB/c) IgE, κ; Reactivity: Trinitrophenol (TNP); Apps: ELISA, FC, WB; Size: 100 μg
Supplier:  TCI America
Description:   CAS Number: 4350-84-9
MDL Number: MFCD06797111
Molecular Formula: C7H10O2
Molecular Weight: 126.16
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 123
Melting point (°C): 128
MSDS SDS
Supplier:  ALADDIN SCIENTIFIC
Description:   (Acetylmethylene)triphenylphosphorane ≥98%
New Product
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,225 - 8,240  of 19,966