Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

You Searched For:

3,5-Difluoro-2-hydroxybenzonitrile


0  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"0"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  AMBEED, INC
Description:   Bis[3-(trimethoxysilyl)propyl]amine ≥96%
New Product
Supplier:  AMBEED, INC
Description:   3',5'-Bis(trifluoromethyl)acetophenone 98%
Supplier:  Matrix Scientific
Description:   MF=C8H11CLN2OS MW=218.71 CAS=199851-22-4 MDL=MFCD03453082 5G
Catalog Number: (220025-286)

Supplier:  R&D Systems
Description:   The Recombinant Mouse IL-22 Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-22 Protein has been validated for the following applications: Bioactivity.
Supplier:  AMBEED, INC
Description:   3,3'-(Oxybis(methylene))bis(3-ethyloxetane) 95%
Supplier:  TCI America
Description:   CAS Number: 66131-14-4
MDL Number: MFCD00059808
Molecular Formula: C6H6Br2O4
Molecular Weight: 301.92
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 75
Storage Temperature: <0°C
MSDS SDS
Supplier:  Matrix Scientific
Description:   MDL Number: MFCD00000387
MSDS SDS
Catalog Number: (75928-884)

Supplier:  Rockland Immunochemical
Description:   A novel cytokine, designated IL-TIF for IL-10 related T cell-derived inducible factor and IL-22, was recently identified. The receptor for IL-22 (IL-22R, also termed CRF2-9 and IL-TIF-R1 chain) is a new member of the class II cytokine receptor family. IL-22R forms a complex with IL-10 receptor beta chain and mediates IL-22 signaling. IL-22 and its receptor activate JAK-STAT signaling pathway. IL22R is expressed in normal liver and kidney and their cell lines HepG2 and TK-10. A soluble form of IL-22 receptor, also termed IL-22 binding protein (IL-22BP) and IL-22 receptor-alpha 2 (IL-22RA2), was identified very recently. IL-22BP prevents binding of IL-22 to the functional cell surface IL-22R complex and neutralizes IL-22 activity. LPS induces IL-22 expression, which indicates the role of IL-22 in inflammatory response.
Supplier:  TCI America
Description:   2,7-Bis[N,N-bis(4-methoxyphenyl)amino]-9,9-spirobi[9H-fluorene], Purity: >98%, CAS: 1138220-69-5, MF: C53H42N2O4, MW: 770.93, Synonyms: N,N,N',N'-Tetrakis(4-methoxyphenyl)-9,9'-spirobi[9H-fluorene]-2,7-diamine, Size: 200MG
Catalog Number: (101792-150)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 007188-1G , MDL Number: MFCD00128904
Supplier:  AMBEED, INC
Description:   1,2-Bis(4-bromophenyl)-1,2-diphenylethene 98%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 048602-5G , MDL Number: MFCD12922679
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  TCI America
Description:   CAS Number: 90076-65-6
Molecular Formula: C2F6LiNO4S2
Molecular Weight: 287.08
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 235
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Bis(triphenylphosphine)palladium(II) diacetate 99%
Supplier:  Thermo Scientific Chemicals
Description:   5G
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,417 - 0  of 0