Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,848  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"5848"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10207-084)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Advanced glycosylation end product-specific receptor(AGER) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Supplier:  Boster Biological Technology
Description:   Mouse IgG monoclonal antibody for Episialin, EMA, mucin 1, cell surface associated (MUC1) detection. Tested with IHC-P, IHC-F in Human. No cross reactivity with other proteins.
Supplier:  Boster Biological Technology
Description:   Mouse IgG monoclonal antibody for Pan-Cadherin, cadherin 1, type 1, E-cadherin (epithelial); cadherin 2, type 1, N-cadherin (neuronal); cadherin 3, type 1, P-cadherin (placental) (CDH1; CDH2; CDH3 ) detection. Tested with WB, IHC-P in Human;mouse;rat;rabbit;chicken;snake. No cross reactivity with other proteins.

Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of Rat Endostatin
Catalog Number: (10207-894)

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Mouse OPN
Catalog Number: (10208-028)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB in Human.
Catalog Number: (10207-774)

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Human MCP-1
Catalog Number: (76464-906)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for liver FABP detection. Tested with WB, Direct ELISA in Mouse;Rat.

Supplier:  Boster Biological Technology
Description:   BMP5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) Alternative Names: BMP-5, BMP5, Size: 50ug/vial
Catalog Number: (10209-780)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Nuclear respiratory factor 1(NRF1) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.
Catalog Number: (76173-004)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number: (76465-232)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Annexin VI detection. Tested with WB, IHC-P, Direct ELISA in Human;Mouse;Rat.
Catalog Number: (10207-278)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Beta-hexosaminidase subunit alpha(HEXA) detection. Tested with WB in Human.
Catalog Number: (10206-234)

Supplier:  Boster Biological Technology
Description:   Polyclonal antibody for Prolactin/Prl detection. Host: Rabbit.Size: 100μg/vial. Tested applications: ELISA. Reactive species: Mouse. Prolactin/Prl information: Molecular Weight: 25496 MW; Subcellular Localization: Secreted.

Supplier:  Boster Biological Technology
Description:   HRP conjugated goat mouse IgG (gamma-chain specific) secondary antibody. Application: Dotblot, ELISA, WB. Pack Size: 0.5mg
Catalog Number: (10205-984)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Dihydrolipoyl dehydrogenase, mitochondrial(DLD) detection. Tested with WB, IHC-P; IHC-F; ICC in Human;Mouse;Rat.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,209 - 2,224  of 5,848