Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,848  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"5848"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (76173-644)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 6(STAT6) detection. Tested with WB in Human;Rat.

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Human TGF-beta 2

Supplier:  Boster Biological Technology
Description:   FITC conjugated goat rabbit IgG secondary antibody. Application: FCM, IHC-P, IHC-F, ICC. Pack Size: 0.5mg
Catalog Number: (76174-678)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Osteocalcin(BGLAP) detection. Tested with IHC-P in Rat.
Catalog Number: (10206-564)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Netrin-1(NTN1) detection. Tested with WB in Human;Mouse;Rat.

Supplier:  Boster Biological Technology
Description:   Mouse IgG monoclonal antibody for Tau, microtubule-associated protein tau (MAPT) detection. Tested with WB, IHC-P in Human;mouse;rat. No cross reactivity with other proteins.

Supplier:  Boster Biological Technology
Description:   14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6G5, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial
Catalog Number: (76465-106)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for TNFRSF18 detection. Tested with WB, Direct ELISA in Human.
Catalog Number: (76171-772)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Breast cancer metastasis-suppressor 1(BRMS1) detection. Tested with WB in Human;Mouse;Rat.
Catalog Number: (10205-842)

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Human CA9
Catalog Number: (10209-982)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Cell division cycle 5-like protein(CDC5L) detection. Tested with WB in Human;Rat.
Catalog Number: (76174-360)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Catalog Number: (10207-698)

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Mouse TREM-1

Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of Rat E-Cadherin
Catalog Number: (76173-518)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Glucocorticoid receptor(NR3C1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of Human Hemojuvelin/RGM-C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,825 - 3,840  of 5,848