Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"3"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10062-644)

Supplier:  Prosci
Description:   16 amino acid peptide near the center of human IL-15RA.
Supplier:  AMBEED, INC
Description:   N-Carbobenzoxy-O-tert-butyl-L-serine 97%
New Product
Supplier:  MP Biomedicals
Description:   L-Lysine is an essential proteinogenic α amino acid. It contains an N-butyl amino group in the side chain, and this moiety is protonated at physiological pH. In addition, L-lysine is one of the two amino acids that are degraded to give ketone bodies (a ketogenic amino acid).
Supplier:  TCI America
Description:   N-(Tert-Butoxycarbonyl)-4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl)Aniline, Purity: >99.0%(HPLC)(T), Cas no: 330793-01-6, Molecular formula : C17H26BNO4, Molecular weight : 319.21, Size: 1G

Supplier:  LGC STANDARDS
Description:   2-Amino-4-chlorophenol, TRC, LGC Standards
New Product
Supplier:  AMBEED, INC
Description:   Nα-Fmoc-Nω-(p-toluenesulfonyl)-L-arginine 97%
Supplier:  MORAVEK BIOCHEMICALS MS
Description:   L-Phenylalanine
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   L-Arginine hydrochloride 98.5-101.0% USP, Multi-Compendial, meets analytical specification of ChP, BP, JP, Ph. Eur., Macron Fine Chemicalsâ„¢
Catalog Number: (76001-926)

Supplier:  Enzo Life Sciences
Description:   Produced in E. coli. Non-glycosylated protein, containing 289 amino acids.
Supplier:  AAT BIOQUEST INC
Description:   DABCYL, SE is the amino-reactive form of DABCYL, and widely used to prepare a variety of FRET-based probes that contain DABCYL.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  Promega Corporation
Description:   Glycine is an amino acid used in the preparation of some electrophoresis buffers.
Supplier:  Bachem Americas
Description:   Sequence: Boc-Arg-OH
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Light green SF yellowish, pure, high purity biological stain
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042372-250MG , MDL Number: MFCD01863056
Supplier:  Thermo Scientific Chemicals
Description:   Concentration: 50 mg/ml
MSDS SDS

Supplier:  Anaspec Inc
Description:   This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
241 - 3  of 3
Prev