Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

trans-4-Aminocyclohexanecarboxylic+acid+hydrochloride


8  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"8"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (89007-840)

Supplier:  Brady Worldwide
Description:   Versatile sign posts for permanent or temporary use
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042767-1G , MDL Number: MFCD03791142

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   4-(Chloromethyl)benzyl alcohol 97%
Catalog Number: (101418-938)

Supplier:  Strem Chemicals Inc
Description:   SEGPHOS
Supplier:  AMBEED, INC
Description:   ((2R,3R,4S,5R)-3-(Benzoyloxy)-5-(6-chloro-9H-purin-9-yl)-4-fluorotetrahydrofuran-2-yl)methyl benzoate ≥97%
New Product
Supplier:  AMBEED, INC
Description:   2-(4-(((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)(2,4-dimethoxyphenyl)methyl)phenoxy)acetic acid, Purity: 98%, CAS number: 126828-35-1, Appearance: White to yellow powder or crystals, Storage: Sealed in dry, 2-8C, Size: 10G

Supplier:  United Scientific Supplies
Description:   Cork stoppers function as a closure for bottles, vials, laboratory vessels and other openings.
Supplier:  AMBEED, INC
Description:   (S)-2-Amino-3-(1H-imidazol-4-yl)propanoic acid hydrochloride, Purity: 97%, CAS Number: 645-35-2, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 25G
Supplier:  Electron Microscopy Sciences
Description:   The strainers are available in the sizes of 35, 40, 70 and 100 microns.
Minority or Woman-Owned Business Enterprise
Supplier:  Wilmad-LabGlass
Description:   These borosilicate glass gas washing bottles are generally used to saturate or dry gas streams.
Supplier:  AMBEED, INC
Description:   4-[(tert-Butoxycarbonylamino)methyl]phenylboronic acid pinacol ester 95%
Supplier:  AOB CHEM USA
Description:   3-(Methoxycarbonyl)phenylboronic acid pinacol ester ≥97%
Supplier:  MilliporeSigma
Description:   Clear liquid. For low level trace metal analysis. Double-distilled and packaged in ISO Class 4 (FED-STD-209E Class 10/M2.5) cleanroom conditions. Supplied in specially designed, preleached fluoropolymer resin bottles to guarantee product integrity. Certificate of Analysis supplied.
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 047478-5G , MDL Number: MFCD01114751
Catalog Number: (101925-020)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 063037-500MG , MDL Number: MFCD00022570
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,105 - 8  of 8