Text Search >
(2S,2'S)-2,2'-(Hexadecanedioylbis(azanediyl))dipentanedioic+acid
Print…
You Searched For:
155,351 results were found
(2S,2'S)-2,2'-(Hexadecanedioylbis(azanediyl))dipentanedioic+acid
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Trypsin Inhibitor (Soybean) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Rabbit IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(RL100-101-238)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Glutamine Synthetase (Microbial) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Xylenol orange tetrasodium salt, water soluble, pure
Supplier:
TCI America
Description:
CAS Number: 51498-37-4
MDL Number: MFCD02093473 Molecular Formula: C5H5NO4S Molecular Weight: 175.16 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal Flash Point (°C): 100
Catalog Number:
(103680-190)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mature form of human CCL15 (Q16663-1) (Gln 22-Ile 113) was expressed, with a polyhistide tag at the C-terminus.
Supplier:
TCI America
Description:
CAS Number: 399-76-8
MDL Number: MFCD00005612
Molecular Formula: C9H6FNO2
Molecular Weight: 179.15
Purity/Analysis Method: <gt/>98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 249
Catalog Number:
(TCD2280-025ML)
Supplier:
TCI America
Description:
CAS Number: 81749-14-6
MDL Number: MFCD00191422 Molecular Formula: C15H28O4 Molecular Weight: 272.39 Purity/Analysis Method: >98.0% (GC) Form: Clear Liquid Boiling point (°C): 102 Specific Gravity (20/20): 0.96
Catalog Number:
(101912-708)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 057193-100G , MDL Number: MFCD00007607
Catalog Number:
(10667-364)
Supplier:
Bioss
Description:
Members of the BAGE gene family encode antigens that are recognized by cytotoxic T lymphocytes and are also known as CT (cancer/testis) antigens. Generated by juxtacentromeric shuffling of the MLL3 gene, the ancestral BAGE gene was expanded by acrocentric exchanges and/or juxtacentromeric movements.Generally, BAGE proteins are silent in all normal tissues with the exception of testis. BAGE2 and BAGE 3 (B melanoma antigen 2 and 3, respectively), also known as Cancer/testis antigen 2.2 and 2.3 (respectively), are 109 amino acid secreted proteins that are expressed in 22% of melanomas, lung and bladder carcinomas, and are also expressed in normal testis tissue. Like the genes encoding MAGE proteins, BAGE genes are most likely silenced by DNA methylation and/or chromatin compaction in normal tissues other than testis.
Catalog Number:
(10667-358)
Supplier:
Bioss
Description:
Members of the BAGE gene family encode antigens that are recognized by cytotoxic T lymphocytes and are also known as CT (cancer/testis) antigens. Generated by juxtacentromeric shuffling of the MLL3 gene, the ancestral BAGE gene was expanded by acrocentric exchanges and/or juxtacentromeric movements.Generally, BAGE proteins are silent in all normal tissues with the exception of testis. BAGE2 and BAGE 3 (B melanoma antigen 2 and 3, respectively), also known as Cancer/testis antigen 2.2 and 2.3 (respectively), are 109 amino acid secreted proteins that are expressed in 22% of melanomas, lung and bladder carcinomas, and are also expressed in normal testis tissue. Like the genes encoding MAGE proteins, BAGE genes are most likely silenced by DNA methylation and/or chromatin compaction in normal tissues other than testis.
Catalog Number:
(101784-014)
Supplier:
BeanTown Chemical
Description:
CAS: 541-16-2; EC No: 208-769-6; MDL No: MFCD00008810
Liquid; Linear Formula: (CH3)3COCOCH2COOC(CH3)3; Molecular Formula: C11H20O4; MW: 216.28
Melting Point: -7 - -6°; Boiling Point: 110-111°/22 mmHg; Flash point: 89°C (192°F)
Density (g/mL): 0.966; Refractive Index: 1.418
Catalog Number:
(101849-810)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 040589-500MG , MDL Number: MFCD12028297
Catalog Number:
(RL609-6302)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Human IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
