Text Search >
(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid
Print…
You Searched For:
163,563 results were found
(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid
Catalog Number:
(103622-006)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the Glutathione S-transferase (P08515) (Met 1-Lys 218), with additional 11 amino acids at the C-terminus, was expressed and purified.
Supplier:
Bachem Americas
Description:
Sequence: H-4-Cyano-Phe-OH
Catalog Number:
(103007-120)
Supplier:
Anaspec Inc
Description:
This is the scrambled beta-Amyloid peptide amino acids 25 to 35. Pairing this peptide with the native b-Amyloid 25 to 35 amino acids peptide has been used to recognize its structure and functions.
Sequence: MAKGINGISGL Molecular Weight: 1060.3 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
Bachem Americas
Description:
Sequence: H-Pen-OH
Catalog Number:
(10338-990)
Supplier:
Bioss
Description:
RAP2B belongs to a family of RAS-related GTP-binding proteins. RAP proteins share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. However, at their 61st amino acid the glutamine in RAS proteins is replaced by threonine in RAP proteins. RAP2A interacts with phospholipase C, epsilon 1 (PLCE1).
Catalog Number:
(103009-742)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ MW:3248.51 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103006-584)
Supplier:
Anaspec Inc
Description:
This glycopeptide is a 16-amino acid modified fragment of mucin 5/MUC5AC, where T* is a GalNac labeled threonine 3. Mucin-type linkages (GalNAc 1-O-Ser/Thr) are initiated by a family of glycosyltransferases known as the UDP-N-acetylgalactosamine:polypeptide N-acetylgalactosaminyltransferases (ppGaNTases). These enzymes transfer GalNAc from the sugar donor UDP-GalNAc to serine and threonine residues, forming an alpha anomeric linkage. The MUC5AC gene, which is mainly expressed in gastric and respiratory mucosae, exhibits 8 amino acid tandemly repeated domain, the consensus peptide TTSTTSAP.
Sequence:GT-T*-PSPVPTTSTTSAP (* = GalNAc-modified residue) MW:1703.9 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103678-484)
Supplier:
Sino Biological
Description:
The mature form of the human cystatin F (NP_003641.3) (Met 1-His 145) with five amino acids (DDDDK) at the C-terminus was expressed and purified.
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-Thr(Trt)-OH
Supplier:
Bachem Americas
Description:
Sequence: H-His(3-Me)-OH
Supplier:
AMBEED, INC
Description:
Fmoc-α-methylalanine 98%
Supplier:
Bachem Americas
Description:
Sequence: H-p-Nitro-Phe-OH
Catalog Number:
(76172-036)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Cationic amino acid transporter 3(SLC7A3) detection. Tested with WB in Human.
Catalog Number:
(10483-980)
Supplier:
Bioss
Description:
BOLA1 (BolA-like protein 1), also known as CGI-143, is a member of the BolA/yrbA family of proteins. Members of this family are homologs of the Escherichia coli protein, BolA. BolA-like proteins are evolutionarily conserved from prokaryotes to eukaryotes and are believed to play a role in cell-cycle regulation or cell proliferation possibly via some sort of transcription regulation of other genes. In addition, BolA-like proteins may contain nucleic-acid binding properties, as is suggested by a fold structure that is similar to the KH-fold, a motif known to participate in nucleic-acid binding. Characteristic of BolA-like proteins which typically consist of approximately 100 amino acids, BOLA1 is a 137 amino acid protein.
Catalog Number:
(103622-798)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human SIGLEC5 (O15389) (Met1-Thr 434) was expressed with six amino acids (LEVLFQ) at the C-terminus was expressed and purified.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
