Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-(2-Methoxyphenoxy)benzoic+acid


141,640  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"141640"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AOB CHEM USA
Description:   8-(2,5-Difluorophenyl)-1,4-dioxaspiro[4.5]Decan-8-ol ≥95%
New Product
Supplier:  AMBEED, INC
Description:   4-(3,5-Difluorophenyl)tetrahydro-2H-pyran-4-ol 95%
Supplier:  AOB CHEM USA
Description:   (4-(Benzyloxy)-5-bromo-2,3-difluorophenyl)boronic acid ≥97%
Supplier:  AMBEED, INC
Description:   (5-Bromo-2,3-difluorophenyl)boronic acid, Purity: 97%, CAS Number: 2096339-65-8, Appearance: Solid, Storage: Inert atmosphere, 2-8 deg C, Size: 5g
Supplier:  AMBEED, INC
Description:   (5-Chloro-2,3-difluorophenyl)boronic acid, Purity: 97%, CAS Number: 2377610-07-4, Appearance: Solid, Storage: Inert atmosphere, 2-8 deg C, Size: 250mg
Supplier:  Anaspec Inc
Description:   This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human IGHE (AAB59395.1) (Cys208-Lys427) was expressed with a polyhistidine tag at the C-terminus.
Supplier:  AOB CHEM USA
Description:   8-(3,4-Difluorophenyl)-1,4-Dioxaspiro[4.5]decan-8-ol ≥95%
Supplier:  AMBEED, INC
Description:   (6-Fluoroimidazo[1,2-a]pyridin-3-yl)(phenyl)methanone, Purity: 97%, CAS Number: 1634647-80-5, Appearance: Yellow solid, Storage: Sealed in dry, Room Temperature, Size: 250mg

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 057299-1G , MDL Number: MFCD05189458
Supplier:  AOB CHEM USA
Description:   1-(3,5-Difluorophenyl)ethanol ≥97% research grade
Supplier:  AMBEED, INC
Description:   1-(2,5-Difluorophenyl)ethan-1-ol, Purity: 95%, CAS Number: 3874-31-5, Appearance: Liquid, Storage: Sealed in dry, Room Temperature, Size: 250MG
Supplier:  Bioss
Description:   Ankyrins are membrane adaptor molecules that play important roles in coupling integral membrane proteins to the spectrin-based cytoskeleton network. Mutations of ankyrin genes lead to severe genetic diseases such as fatal cardiac arrhythmias and hereditary spherocytosis. ANKRD26 (ankyrin repeat domain-containing protein 26) is a 1709 amino acid protein that contains five ANK repeats. Expressed at high level in many tissues, including brain, liver, kidney and heart, ANKRD26 may be phosphorylated upon DNA damage by Atm or ATR. ANKRD26 is also expressed in the arcuate and ventromedial nuclei within the hypothalamus and in the ependyma and the circumventricular organs that act as an interface between the peripheral circulation and the brain. It is suggested that alterations in the gene encoding ANKRD26 may lead to obesity. Three isoforms of ANKRD26 exists due to alternative splicing events.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   (2,4-Difluorophenyl)acetone 98%
Supplier:  AMBEED, INC
Description:   (3,4-Difluorophenyl)hydrazine hydrochloride 98%

Supplier:  Matrix Scientific
Description:   3-(3,5-Difluorophenyl)-2-methyl-1-propene ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,137 - 3,152  of 141,640