Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1,4-Dibromohexafluoro-2-butene


22,757  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22757"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Ansamitocin P-3 98% P-3 major, mix(P-0, P-1, P-2, P-3, P-3’, P-4, P-4’)
New Product
Catalog Number: (89357-246)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to 14-3-3 sigma (stratifin)

Supplier:  ABCAM INC.
Description:   Anti-Tim 2 Rabbit Monoclonal Antibody [clone: RMT2-14]
New Product
Supplier:  ABCAM INC.
Description:   Anti-MEF2C Rabbit Monoclonal Antibody [clone: EPR1452-14]
New Product

Supplier:  Boster Biological Technology
Description:   14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6H7, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial
Supplier:  ALADDIN SCIENTIFIC
Description:   A dihydropyridine calcium channel blocker; activity resides mainly in the (-)-isomer.
New Product
Supplier:  AOB CHEM USA
Description:   2,4-Dibromo-3-fluoropyridine ≥97%
New Product
Supplier:  AMBEED, INC
Description:   2,5-Diaminobenzene-1,4-diol dihydrochloride, Purity: 95%, CAS Number: 24171-03-7, Appearance: Form: powder Colour:Off white - grey - pale purple, Storage: Inert atmosphere, Room Temperature, Size: 100mg
Supplier:  TCI America
Description:   2,5-Dichloro-3,4-ethylenedioxythiophene, Purity: >98.0%(GC), CAS Number: 225518-49-0, Molecular Formula: C6H4Cl2O2S, Synonym: 5,7-Dichloro-2,3-dihydrothieno[3,4-b][1,4]dioxine, Form: Crystal-Powder, Solid, Color: White - Yellow, Size: 1G
MSDS SDS
Supplier:  AMBEED, INC
Description:   3-Fluoro-4-methoxyphenylacetic acid, Purity: 97%, CAS number: 452-14-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 10G

Supplier:  AMBEED, INC
Description:   1-(4-Bromophenyl)imidazolidin-2-one, Purity: 95%, CAS number: 530081-14-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100MG
Supplier:  AMBEED, INC
Description:   1-Phenyl-1-butanol 96%
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant rabbit monoclonal [KRT14/8691R] antibody to Cytokeratin 14 for IHC-P with samples derived from Human.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [KRT14/4128] antibody to Cytokeratin 14 for WB and IHC-P with samples derived from Human.
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant rabbit monoclonal [KRT14/8261R] antibody to Cytokeratin 14 for IHC-P with samples derived from Human.

Supplier:  RevMAb Biosciences
Description:   This antibody reacts to Histone H3 dimethylated at Lysine 14 (K14me2). No cross reactivity with monomethylated Lysine 14 (K14me1) or trimethylated Lysine 14 (K14me3), or other methylation in histone H3.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,265 - 5,280  of 22,757