Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1,4-Dioxaspiro[4.5]decane-8-methanol


42,181  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"42181"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  BeanTown Chemical
Description:   CAS: 7429-90-5; EC No: 231-072-3; MDL No: MFCD00134029; RTECS: BD0330000 UN No: UN1396; Haz Class: 4.3; Packing Group: II Powder; Molecular Formula: Al; MW: 26.98 Melting Point: 660.4°; Boiling Point: 2460° Density (g/mL): 2.7
MSDS SDS
Catalog Number: (103617-806)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human 14-3-3 eta / YWHAH (rh 14-3-3 eta / YWHAH; Catalog#10847-H09E; Q04917; Gly2-Asn246). 14-3-3 eta / YWHAH specific IgG was purified by Human 14-3-3 eta / YWHAH affinity chromatography.
Catalog Number: (103618-050)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human 14-3-3 beta / YWHAB (rh 14-3-3 beta / YWHAB; Catalog#10843-H09E; NP_003395.1; Met1-Asn246). 14-3-3 beta / YWHAB specific IgG was purified by Human 14-3-3 beta / YWHAB affinity chromatography.
Catalog Number: (103007-822)

Supplier:  Anaspec Inc
Description:   Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This peptide sequence is found in residues 45 to 54 of Metastin (also referred to as Kisspeptin-10). This peptide increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone) in prepubertal dairy heifers. This peptide is the minimal sequence needed to activate GPR54 signaling, which may function in negatively regulating CXCR4’s role in programming tumor metastasis. Specifically, Kisspeptin-10 inhibits signaling and chemotaxis induced by SDF-1.
Sequence:YNWNSFGLRF-NH2
MW:1302.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Thermo Scientific Chemicals
Description:   PBDB-T (PCE12), Poly[(2,6-(4,8-bis(5-(2-ethylhexyl)thiophen-2-yl)-benzo[1,2-b:4,5-b]dithiophene))-alt-(5,5-(1,3-di-2-thienyl-5,7-bis(2-ethylhexyl)benzo[1,2-c:4,5-c]dithiophene-4,8-dione)], Formula: (C68H78O2S8)n, Storage and Sensitivity: Ambient temperatures, Size: 500mg
Supplier:  AMBEED, INC
Description:   (2,2-Difluorobenzo[d][1,3]dioxol-5-yl)methanol, Purity: 98%, CAS Number: 72768-97-9, Appearance: Liquid, Storage: Sealed in dry, 2-8C, Size: 25G
Catalog Number: (76464-162)

Supplier:  Boster Biological Technology
Description:   14-3-3 zeta Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ). Alternative Names: YWHAZ, 1433 zeta, Applications: WB, Size: 100ug/vial
Supplier:  TCI America
Description:   CAS Number: 100-79-8
MDL Number: MFCD00063238
Molecular Formula: C6H12O3
Molecular Weight: 132.16
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 80
Flash Point (°C): 80
Specific Gravity (20/20): 1.07
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: L-4,5,6,7-Tetrahydro-1H-imidazo[4,5-c]pyridine-6-carboxylic acid
Supplier:  AMBEED, INC
Description:   (3-Chloro-4-(trifluoromethoxy)phenyl)methanol, Purity: 98%, CAS Number: 56456-48-5, Appearance: White to Yellow Solid, Storage: Sealed in dry, Room Temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   (3,5-Dimethylphenyl)methanol, Purity: 98%, CAS Number: 27129-87-9, Appearance: Colorless to Yellow Liquid, Storage: Sealed in dry, Room Temperature, Size: 1g
Supplier:  Sheldon Manufacturing
Description:   The Bead Bath's eco-friendly, state-of-the-art design takes full advantage of the robust properties of Lab Armor Beads
Small Business Enterprise Irregular Voltage
Supplier:  TCI America
Description:   CAS Number: 74-31-7
MDL Number: MFCD00003015
Molecular Formula: C18H16N2
Molecular Weight: 260.34
Purity/Analysis Method: >95.0% (T)
Form: Crystal
Boiling point (°C): 225
Melting point (°C): 152
Flash Point (°C): 236
Supplier:  VWR International
Description:   VWR® Black Phenolic Caps provide a wide range of chemical compatibility and temperature tolerance with an assortment of liners to choose from.
Supplier:  AMBEED, INC
Description:   (Perfluorophenyl)methanol, Purity: 95%, CAS Number: 440-60-8, Appearance: Solid or Semi-solid or liquid or lump, Storage: Sealed in dry, Room Temperature, Size: 10g
Supplier:  AMBEED, INC
Description:   Phenyl(4-(trifluoromethyl)phenyl)methanol, Purity: 97%, CAS Number: 395-23-3, Appearance: White to off-white solid, Storage: Sealed in dry, 2-8C, Size: 1G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
9,601 - 9,616  of 42,181