Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

3-(3,5-Dichlorophenylcarbamoyl)-4-fluorophenylboronic+acid


15,749  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"15749"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   (11bR)-N-(2,6-Bis(3,5-bis(trifluoromethyl)phenyl)-4-oxidodinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-yl)-1,1,1-trifluoromethanesulfonamide, Purity: 97%, CAS Number: 1010800-02-8, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1G
Supplier:  Matrix Scientific
Description:   MF=C13H13Cl2N5 MW=310.19 MDL=MFCD01562627 ,500Mg
Supplier:  BeanTown Chemical
Description:   CAS: 63370-90-1; MDL No: MFCD01863471 Powder; Molecular Formula: C44H80HfO8 ; MW: 915.60 Melting Point: 315°
MSDS SDS

Supplier:  Matrix Scientific
Description:   MF=C8H11N3O4 MW=213.19 MDL=MFCD00455794 500Mg
Supplier:  Strem Chemicals Inc
Description:   Metal Beta-diketonates, Metal TMHD, Volatile Precursors for CVD
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   The J.T.Baker® BAKERBOND® PolyQUAT multimode ion exchange (IEX) chromatography resin functions as a strong anion exchange resin with improved selectivity for superior separation in process chromatography applications.
MSDS SDS
Supplier:  AMBEED, INC
Description:   4-Bromo-2-methoxythiazole, Purity: 98%, CAS number: 240816-35-7, Appearance: Liquid or Solid or Semi-solid, Storage: Inert atmosphere, 2-8C, Size: 1G
Supplier:  AMBEED, INC
Description:   (E)-3-(4-(Trifluoromethoxy)phenyl)acrylic acid, Purity: 95%, CAS Number: 199679-35-1, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 25g
Supplier:  AMBEED, INC
Description:   2-Bromo-6-isopropylpyridine, Purity: 97%, CAS Number: 1037223-35-0, Appearance: Colorless to light-yellow liquid, Storage: Inert atmosphere, Room Temperature, Size: 10G
Catalog Number: (103007-366)

Supplier:  Anaspec Inc
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   2-Bromo-1-[3,5-di(tert-butyl)-4-hydroxyphenyl]ethan-1-one, Purity: 98%, CAS Number: 14386-64-2, Appearance: White to Yellow Solid, Storage: Inert atmosphere, 2-8 C, Size: 5g
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 034694-1G , MDL Number: MFCD11226666
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 020905-500MG , MDL Number: MFCD00030408
Supplier:  Bachem Americas
Description:   The neurotoxicity of the short fragment IIGLM is similar to that of amyloid β-protein (1-42) (H-1368). Aβ 31-35 induced apoptosis in undifferentiated PC 12 cells.
Supplier:  TCI America
Description:   CAS Number: 10366-35-5
MDL Number: MFCD00006237
Molecular Formula: C6H5ClN2O
Molecular Weight: 156.57
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 164
MSDS SDS
Supplier:  AMBEED, INC
Description:   4-Chloro-N-(5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl)benzamide, Purity: 98+%, CAS Number: 865285-29-6, Appearance: White to beige powder or crystals, Storage: Sealed in dry, 2-8C, Size: 5MG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,401 - 4,416  of 15,749