Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-(4-Hydroxyphenyl)hex-4-ynoic+acid


12,593  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"12593"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   N-([1,1'-Biphenyl]-2-yl)-7-nitrobenzo[c][1,2,5]oxadiazol-4-amine, Purity: 98%, CAS Number: 413611-93-5, Appearance: Form: solid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 1mg
Supplier:  Novus Biologicals
Description:   The hydroxysteroid (17-beta) dehydrogenase 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to hydroxysteroid (17-beta) dehydrogenase 11. This antibody reacts with human. The hydroxysteroid (17-beta) dehydrogenase 11 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  AFG BIOSCIENCE LLC
Description:   Human Interleukin-11 Receptor Subunit α (IL-11Rα) ELISA Kit, AFG Bioscience
Supplier:  AMBEED, INC
Description:   5,6-Dibromopyridin-2-amine, Purity: 97%, CAS number: 89284-11-7, Appearance: White to Yellow Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100MG
Supplier:  Strem Chemicals Inc
Description:   BINAP
Supplier:  AMBEED, INC
Description:   6-Chloro-4-hydroxy-2-methyl-2H-thieno[2,3-e]-1,2-thiazine-3-carboxylic acid methyl ester 1,1-dioxide, Purity: 95%, CAS Number: 70415-50-8, Appearance: Almost white to light yellow or light yellow-greenish powder, Storage: Inert atmosphere, 2-8C, Size: 5G
Catalog Number: (103005-822)

Supplier:  Anaspec Inc
Description:   Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  AMBEED, INC
Description:   (S)-2-Amino-2-(thiazol-2-yl)ethanol dihydrochloride, Purity: 97%, CAS Number: 2682097-11-4, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   Chloro(2-{bis[3,5-bis(trifluoromethyl)phenyl]phosphino}-3,6-dimethoxy-2',4',6'-triisopropyl-1,1'-biphenyl)gold(I) ≥98%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 062937-500MG , MDL Number: MFCD01579587
Supplier:  AMBEED, INC
Description:   6-Chloro-3-(dichloromethyl)-3,4-dihydro-2H-benzo[e][1,2,4]thiadiazine-7-sulfonamide 1,1-dioxide, Purity: 98%, CAS Number: 133-67-5, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250MG
Supplier:  APOLLO SCIENTIFIC
Description:   2-Fluoro-5-methyl-4-(trifluoromethyl)phenylacetonitrile 98%
Supplier:  ZING Enterprises
Description:   The sign is available in 1 size, 11 x 11", and in recycled plastic
Environmentally Preferable
Supplier:  AMBEED, INC
Description:   4-(Oxazol-2-yl)aniline, Purity: 98%, CAS Number: 62882-11-5, Appearance: Solid, Storage: Keep in dark place, Sealed in dry, 2-8C, Size: 100MG
Supplier:  Strem Chemicals Inc
Description:   BINAP
Supplier:  AMBEED, INC
Description:   1,4,8,11-Tetraazacyclotetradecane 97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
625 - 640  of 12,593