Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Pyrido[2,3-d]pyrimidin-4(1H)-one


139,658  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"139658"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  ALADDIN SCIENTIFIC
Description:   N-(2-Aminoethyl)glycine ≥97%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 026076-500MG , MDL Number: MFCD09452929

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 016157-500MG , MDL Number: MFCD06801036
Supplier:  RPI
Description:   Plant cell culture tested.

Supplier:  Anaspec Inc
Description:   6-ROX, SE is the other purified single isomer of 5(6)-ROX, SE. It appears that 5-ROX is more often used than 6-ROX for labeling peptides and proteins. 6-ROX is predominately used for labeling nucleotides and sequencing nucleic acids.

Supplier:  Abnova
Description:   Mouse monoclonal antibody raised against partial recombinant Grin2b.
Supplier:  PeproTech, Inc.
Description:   The IL-1 family is comprised of 11 structurally related ligands, including recently re-named IL-36 α (IL-1F6), β (IL-1F8) and γ (IL-1F9). IL-36γ is highly expressed in psoriatic plaques and in tissues containing epithelial cells. IL-36γ signals through the IL-1Rrp2 (IL-1R6) receptor, which is primarily expressed on certain dendritic cells. The interaction of the IL-1Rrp2 receptor with IL-36 ligands induces dendritic cell maturation and activation. IL-36γ also functions as an agonist of NF-κB, and can stimulate the inflammatory response in bronchial epithelial cells. Recombinant Human IL-36γ (IL-1F9) is a 17.0 kDa protein containing 152 amino acid residues.
Supplier:  Anaspec Inc
Description:   Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Thermo Scientific Chemicals
Description:   5KG
MSDS SDS
Supplier:  Bioss
Description:   FBXO36 is a 188 amino acid protein that contains one forty amino acid F-box region, making it a member of the F-box family. F-box proteins are critical components of the SCF (Skp1-CUL-1-F-box protein) type E3 ubiquitin ligase complex and are involved in substrate recognition and recruitment for ubiquitination. F-box proteins are members of a large family that regulates cell cycle, immune response, signaling cascades and developmental programs by targeting proteins, such as cyclins, cyclin-dependent kinase inhibitors, IkB-Ã¥ and -catenin, for degradation by the proteasome after ubiquitination. Functioning as a component of the SCF complex, FBXO36 is thought to recognize and bind to select phosphorylated proteins, thereby promoting their ubiquitination and subsequent degradation.
Supplier:  MP Biomedicals
Description:   Brilliant Cresyl Blue is a supravital stain used in hematology for demonstrating and counting reticulocytes and platelets. It is also used as a vital stain for demonstrating the mucous secretions of the marine coelomates.
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 040545-500MG , MDL Number: MFCD12028253
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039149-500MG , MDL Number: MFCD12027653

Supplier:  TCI America
Description:   1-Adamantyl methacrylate ≥98.0% (by GC) stabilized
New Product
Supplier:  Sino Biological
Description:   A DNA sequence encoding the Influenza A virus (A/Texas/36/1991(H1N1)) hemagglutinin (ACF41933.1) (Met1-Arg344), termed as HA1, was expressed with a polyhistidine tag at the C-terminus.
Catalog Number: (76270-178)

Supplier:  Avantik
Description:   Optik Type 2 Eosin is an alcoholic eosin with exceptional contrast between cytoplasmic components and nuclei.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,657 - 4,672  of 139,658