Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-(Trifluoromethyl)benzenesulphonamide


31,724  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"31724"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> Non-glycosylated, disulfide linked homodimer, containing two identical 113 amino acid chains.
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-Abu-OH
Catalog Number: (10103-146)

Supplier:  Prosci
Description:   Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. EPRS is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Supplier:  PeproTech, Inc.
Description:   Mature Myostatin is obtained by proteolytic processing of a biologically-inactive precursor protein, which contains an N-terminal propeptide of 243 amino acid residues. Myostatin-Propeptide exhibits high binding affinity for myostatin, and has been shown to be a potent inhibitor of myostatin. Over-expression of myostatin-propeptide in mice resulted in large increases (up to 200%) in skeletal muscle mass, similar to those observed in myostatin knockout mice. Recombinant Human Myostatin-Propeptide is a 27.8 kDa protein consisting of 244 amino acid residues.
Catalog Number: (10112-562)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: ENPP1 antibody was raised against an 11 amino acid synthetic peptide near the C-Terminus of ENPP1, Application: ELISA, WB, IHC
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 021442-500MG , MDL Number: MFCD07788853
Supplier:  Anaspec Inc
Description:   Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), Cat AS-20610, is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYP
MW: 2933.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: (103003-048)

Supplier:  Anaspec Inc
Description:   Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: (76821-496)

Supplier:  AMBEED, INC
Description:   (S)-2-Amino-3-(4-hydroxy-3,5-diiodophenyl)propanoic acid dihydrate, Purity: 98%, CAS Number: 18835-59-1, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Slightly pale reddish yellow, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20C, Size: 10G
Supplier:  Bioss
Description:   Sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Involved in cellular amino acid uptake. Acts as an amino acid exchanger. Involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Plays a role in neuronal cell proliferation (neurogenesis) in brain. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. May play an important role in high-grade gliomas. Mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. Acts as the major transporter of tyrosine in fibroblasts.
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> A non-glycosylated, disulfide-linked homodimer, containing two 113 amino acid chains.
Supplier:  TCI America
Description:   CAS Number: 495-69-2
MDL Number: MFCD00002692
Molecular Formula: C9H9NO3
Molecular Weight: 179.18
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 190
MSDS SDS
Supplier:  TCI America
Description:   [Good's buffer component for biological research]
CAS Number: 150-25-4
MDL Number: MFCD00004295
Molecular Formula: C6H13NO4
Molecular Weight: 163.17
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 195
MSDS SDS
Catalog Number: (10112-466)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: Arylsulfatase B antibody was raised against a 14 amino acid synthetic peptide near the internal region of Arylsulfatase B, Application: ELISA, WB, IHC
Supplier:  PeproTech, Inc.
Description:   TAFA proteins are a newly discovered family of proteins, which are distantly related to MIP-1α, a member of the CC-chemokine family. TAFA mRNAs are highly expressed in specific brain regions. The biological function of TAFA-2 is still unknown. Recombinant Human TAFA-2 is an 11.2 kDa protein consisting of 101 amino acid residues.
Catalog Number: (10113-248)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: C14orf68 antibody was raised against a 13 amino acid synthetic peptide near the internal region of C14orf68, Tested Applications: ELISA, IHC
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,697 - 7,712  of 31,724