Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Methyl 1,4,5,6,7,8-hexahydrocyclohepta[b]pyrrole-2-carboxylate


134,346  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"134346"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 064973-500MG , MDL Number: MFCD18064668
Supplier:  AMBEED, INC
Description:   Methyl 2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)acetate, Purity: 97%, CAS Number: 454185-98-9, Appearance: White to light-yellow powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 250MG
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Perchloric acid 0.1 M in acetic acid, pure
New Product

Supplier:  Matrix Scientific
Description:   MF=C9H8BRCLO2 MW=263.52 CAS=85259-19-4 MDL=MFCD08444353 5G
Catalog Number: (45001-124)

Supplier:  Corning
Description:   Sodium Acetate is a common molecular biology reagent. All production lots are tested to ensure that they are free of RNAse. It is often used in buffer systems to maintain the pH of a given solution.
Supplier:  TCI America
Description:   1-Acetyl-5-bromo-4-chloro-3-indolyl Acetate, Purity: >98.0%(GC), CAS: 3030-06-6, MF: C12H9BrClNO3, Molecular Weight: 330.56, Synonyms: 3-Acetoxy-1-acetyl-5-bromo-4-chloroindole, Form: Crystal- Powder, Very pale yellow - Reddish yellow, Size: 1G
Supplier:  Thermo Fisher Scientific
Description:   Presterilized filter units with surfactant-free cellulose acetate membranes are ideal for proteinaceous solutions.
Environmentally Preferable
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 064863-500MG , MDL Number: MFCD03661168
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 037826-500MG , MDL Number: MFCD12027219
Supplier:  AMBEED, INC
Description:   2-(4-(Trifluoromethoxy)phenoxy)acetic acid, Purity: 95%, CAS Number: 72220-50-9, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   2-(4-Bromo-2-fluorophenyl)acetic acid, Purity: 98%, CAS Number: 114897-92-6, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Sealed in dry, Room Temperature, Size: 25g
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: (77749-375)

Supplier:  AMBEED, INC
Description:   4-Methylhippuric acid ≥98%
New Product

Supplier:  Ricca Chemical
Description:   Chlorobenzene : acetic acid mixture

Supplier:  SI Analytics
Description:   Acetic acid saturated with lithium chloride.
Catalog Number: (TCC0085-25ML)

Supplier:  TCI America
Description:   CAS Number: 97-97-2
MDL Number: MFCD00000948
Molecular Formula: C4H9ClO2
Molecular Weight: 124.56
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 130
Flash Point (°C): 35
Specific Gravity (20/20): 1.09
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,297 - 1,312  of 134,346