Text Search >
2,2-Difluoropropionic+acid
Print…
You Searched For:
153,749 results were found
2,2-Difluoropropionic+acid
Catalog Number:
(103680-190)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mature form of human CCL15 (Q16663-1) (Gln 22-Ile 113) was expressed, with a polyhistide tag at the C-terminus.
Supplier:
MP Biomedicals
Description:
Calcein is an indicator for the determination of calcium by titration with EDTA. The excitation wavelength and emission wavelength are 495/515 nm.
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10670-278)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(10667-342)
Supplier:
Bioss
Description:
Members of the BAGE gene family encode antigens that are recognized by cytotoxic T lymphocytes and are also known as CT (cancer/testis) antigens. Generated by juxtacentromeric shuffling of the MLL3 gene, the ancestral BAGE gene was expanded by acrocentric exchanges and/or juxtacentromeric movements.Generally, BAGE proteins are silent in all normal tissues with the exception of testis. BAGE2 and BAGE 3 (B melanoma antigen 2 and 3, respectively), also known as Cancer/testis antigen 2.2 and 2.3 (respectively), are 109 amino acid secreted proteins that are expressed in 22% of melanomas, lung and bladder carcinomas, and are also expressed in normal testis tissue. Like the genes encoding MAGE proteins, BAGE genes are most likely silenced by DNA methylation and/or chromatin compaction in normal tissues other than testis.
Supplier:
BeanTown Chemical
Description:
CAS: 344-25-2; EC No: 206-452-7; MDL No: MFCD00064317
Powder; Molecular Formula: C5H9NO2; MW: 115.13
Melting Point: 223° (decomposes)
Optical Rotation: [α]22/D +85.0°, c = 4 in water
Hygroscopic
Catalog Number:
(RL613-4329)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Sheep IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL610-1604)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL601-4302)
Supplier:
Rockland Immunochemical
Description:
Anti Bovine IgG antibody has been assayed against 1.0 µg of Bovine IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL200-103-150S)
Supplier:
Rockland Immunochemical
Description:
Anti-Luciferase has been assayed against 1.0 µg of Luciferase (Photinus pyralis (Firefly)) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL200-4369S)
Supplier:
Rockland Immunochemical
Description:
Anti-Esterase has been assayed against 1.0 µg of Esterase (Porcine Liver) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL200-4361S)
Supplier:
Rockland Immunochemical
Description:
Anti-Deoxyribonuclease I has been assayed against 1.0 µg of Deoxyribonuclease I (Bovine Pancreas) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL200-4387S)
Supplier:
Rockland Immunochemical
Description:
Anti-Trypsin Inhibitor has been assayed against 1.0 µg of Trypsin Inhibitor (Lima Bean) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL211-1307)
Supplier:
Rockland Immunochemical
Description:
Rabbit IgM (mu) peroxidase conjugated antibody has been assayed against 1.0 µg of Rabbit IgM in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL712-1333)
Supplier:
Rockland Immunochemical
Description:
Antibody anti-Rat IgG (H&L) peroxidase conjugated has been assayed against 1.0 µg of Rat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL602-4304)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Cat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
