Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl-2-(hydroxyimino)-2-(4-phenylpiperazino)acetate


101,688  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
Your search request has been modified to limit number of results. Your search was -
2,3-Bis(amino((2-aminophenyl)thio)methylene)succinonitrile+compound+with+ethanol+(1:1)
 
 
SearchResultCount:"101688"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10423-650)

Supplier:  Bioss
Description:   Integrins are heterodimeric cell surface receptors composed of alpha and beta subunits, which mediate cell-cell and cell-extracellular matrix attachments. Aberrant integrin expression has been found in many epithelial tumours. Changes in integrin expression have been shown to be important for the growth and early metastatic capacity of melanoma cells. Integrin alpha-v beta-6 is upregulated in cancers and during tissue remodelling but is absent from resting adult tissues. Integrin alpha-v beta-6 promotes invasion and correlates with poor survival and therefore makes a promising therapeutic target.

Supplier:  Prosci
Description:   Heat shock protein beta-8 (HSPB8) belongs to the small heat shock protein (HSP20) family. This protein can be inducted by 17-beta-estradiol, and is predominantly expressed in skeletal muscle and heat, mainly located in the cytoplasm and nucleus. HSPB8 usually exists in monomer, it can interact with HSPB1 and DNAJB6. HSPB8 displays temperature-dependent chaperone activity,appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.
Supplier:  TCI America
Description:   CAS Number: 367-93-1
MDL Number: MFCD00063273
Molecular Formula: C9H18O5S
Molecular Weight: 238.30
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 113
Specific rotation [a]20/D: -32 deg (C=1, H2O)
MSDS SDS
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant rabbit monoclonal [B2M/7013R] antibody to beta 2 Microglobulin for IHC-P with samples derived from Human and Non-Human Primates.
Catalog Number: (89328-994)

Supplier:  Genetex
Description:   Chicken polyclonal antibody to beta Actin
Supplier:  Bon Opus Biosciences
Description:   Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Supplier:  Novus Biologicals
Description:   Thyroid Hormone Receptor beta Overexpression Lysate (Adult Normal)

Supplier:  Prosci
Description:   Actins are ubiquitous globular and highly conserved proteins that are involved in various types of cell motility, structure, and integrity. Three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. ACTB is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others.
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human Integrin alpha 3 beta 1 (ITGA3&ITGB1) Heterodimer Protein, His Tag&Tag Free, ACROBiosystems
Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Novus Biologicals
Description:   Rabbit Polyclonal IL1 beta Antibody [Biotin]. Tested Applications: Western Blot, ELISA, Immunohistochemistry. Tested Reactivity: Mouse, Rat.
Supplier:  Enzo Life Sciences
Description:   Produced in Sf9 cells using an N-terminal GST-tag.
Supplier:  TCI America
Description:   CAS Number: 129575-89-9
Molecular Formula: C35H33NO8
Molecular Weight: 595.65
Purity/Analysis Method: >95.0% (HPLC)
Form: Crystal
Storage Temperature: <0°C
MSDS SDS

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse Glucocorticoid Receptor beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse Glucocorticoid Receptor beta in serum, plasma, tissue homogenates, and other biological fluids.

Supplier:  ANTIBODIES.COM LLC
Description:   Human Glucocorticoid Receptor beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Glucocorticoid Receptor beta in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number: (10423-660)

Supplier:  Bioss
Description:   Integrins are heterodimeric cell surface receptors composed of alpha and beta subunits, which mediate cell-cell and cell-extracellular matrix attachments. Aberrant integrin expression has been found in many epithelial tumours. Changes in integrin expression have been shown to be important for the growth and early metastatic capacity of melanoma cells. Integrin alpha-v beta-6 is upregulated in cancers and during tissue remodelling but is absent from resting adult tissues. Integrin alpha-v beta-6 promotes invasion and correlates with poor survival and therefore makes a promising therapeutic target.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
785 - 800  of 101,688
Prev   1