Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-Ethoxy-4-methylphenylboronic+acid


153,249  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"153249"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Chem Impex International
Description:   Purity limit: ≥750 mg/mg (Microbial Assay on Dried Basis)

Supplier:  Matrix Scientific
Description:   Ethyl-2,4-dihydroxy-6-methylbenzoate ≥97%
Supplier:  TCI America
Description:   CAS Number: 688-13-1
MDL Number: MFCD00066050
Molecular Formula: C8H16N2O3
Molecular Weight: 188.23
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 234
Specific rotation [a]20/D: 35 deg (C=2, H2O)
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   6-Bromonicotinic acid 96%
Supplier:  AMBEED, INC
Description:   Potassium (S)-2-(6-hydroxybenzo[d]thiazol-2-yl)-4,5-dihydrothiazole-4-carboxylate, Purity: 97%, CAS Number: 115144-35-9, Appearance: Form: powder Colour: light-green to yellow, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 250MG
Supplier:  AOB CHEM USA
Description:   2,6-Difluoro-4-formylphenylboronic acid pinacol ester ≥97%
Supplier:  AMBEED, INC
Description:   2,6-Difluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile, Purity: 97%, CAS number: 1003298-73-4, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 10G
Supplier:  PeproTech, Inc.
Description:   Interleukin-35 is a glycosylated, heterodimeric protein consisting of the p35 subunit from IL-12 (IL-12alpha) and the beta subunit from IL-27 (EBI3). IL-35 can be expressed by regulatory T-cells (Tregs), macrophages, and certain trophoblast and dendritic cells. It is induced in response to inflammation, and generally acts as an inflammation suppressor. IL-35 suppresses inflammation by exerting multiple activities, including the induction of regulatory T-cells and the suppression of Th17 cells. Recombinant Human IL-35 produced from HEK293 cells is a glycosylated protein, primarily heterodimeric, that migrates as a diffuse band centered at an apparent molecular weight of about 60 kDa by SDS-PAGE analysis under non-reducing conditions. Recombinant Human IL-35 expressed in HEK293 cells contains 406 amino acid residues and has a calculated molecular weight of 45.8 kDa.
Supplier:  TCI America
Description:   [Optical Resolving]
CAS Number: 20445-31-2
MDL Number: MFCD00004184
Molecular Formula: C10H9F3O3
Molecular Weight: 234.17
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Flash Point (°C): 112
Freezing point (°C): 35
Specific rotation [a]20/D: 72 deg (C=2, MeOH)
MSDS SDS
Supplier:  AOB CHEM USA
Description:   2-Benzyloxy-5-pyridineboronic acid ≥97%
Catalog Number: (102668-050)

Supplier:  Matrix Scientific
Description:   (Ethylamino)(oxo)acetic acid
Supplier:  MORAVEK BIOCHEMICALS MS
Description:   L-Glutamic acid, [3,4-3H] ≥97% (by HPLC), MORpure™
Supplier:  Strem Chemicals Inc
Description:   CAS #: 16903-35-8. Size: 1g.
Catalog Number: (101911-402)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 056788-5G , MDL Number: MFCD08461839
Catalog Number: (89150-416)

Supplier:  Enzo Life Sciences
Description:   Fluoroquinolone with broad spectrum antibacterial activity against Gram-positive and Gram-negative bacteria

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,929 - 2,944  of 153,249