Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+2-(3-Pyrazolyl)acetate


22,668  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22668"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bioss
Description:   Laminin S binds to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminin S is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Beta 2 is a subunit of laminin 3 (Laminin S), laminin 4 (S merosin), and laminin 7 (KS laminin).

Supplier:  R&D Systems
Description:   The Recombinant Human/Feline CXCL12/SDF-1 beta (aa 22-93) from R&D Systems is derived from E. coli. The Recombinant Human/Feline CXCL12/SDF-1 beta (aa 22-93) has been validated for the following applications: Bioactivity.
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Gp130 / CD130 / IL-6 R beta Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Mouse, purity: >95%, Molecular Characterization: MW of 93.3 kDa, Synonym: IL6ST,gp130,CD130,IL-6RB,IL-6R-beta,CDw130, Storage: 4 deg C, Size: 1MG
Supplier:  AMBEED, INC
Description:   1,3,4,6-Tetra-O-acetyl-β-D-glucosamine hydrochloride 97%
Catalog Number: (10162-882)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to IKK-alpha/beta

Supplier:  Novus Biologicals
Description:   The PI 4 Kinase type 2 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI 4 Kinase type 2 beta. This antibody reacts with human. The PI 4 Kinase type 2 beta Antibody has been validated for the following applications: Western Blot.

Supplier:  Novus Biologicals
Description:   The PI 4 Kinase type 2 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI 4 Kinase type 2 beta. This antibody reacts with mouse. The PI 4 Kinase type 2 beta Antibody has been validated for the following applications: Western Blot.

Supplier:  Novus Biologicals
Description:   TNF beta ELISA Kit

Supplier:  Genetex
Description:   Mouse monoclonal antibody [5/25] to Estrogen Receptor beta 5
Supplier:  Novus Biologicals
Description:   The beta-III Tubulin Antibody (2E9) from Novus Biologicals is a mouse monoclonal antibody to beta-III Tubulin. This antibody reacts with human. The beta-III Tubulin Antibody (2E9) has been validated for the following applications: Western Blot, Simple Western, Flow Cytometry, ELISA, Immunocytochemistry / Immunofluorescence.
Catalog Number: (89354-348)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
Catalog Number: (103007-612)

Supplier:  Anaspec Inc
Description:   Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AFG BIOSCIENCE LLC
Description:   Bovine Beta-1, 4-galactosyltransferase 1 (B4GALT1) ELISA Kit, AFG Bioscience
Catalog Number: (89350-094)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Supplier:  AFG BIOSCIENCE LLC
Description:   Monkey Beta-Defensin 123(DEFB123) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Porcine Beta Hydroxybutyric Acid (BHBA) ELISA Kit
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,273 - 4,288  of 22,668