Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

7-Fluoroimidazo[1,2-a]pyridine


142,781  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"142781"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AAT BIOQUEST INC
Description:   DABCYL, SE is the amino-reactive form of DABCYL, and widely used to prepare a variety of FRET-based probes that contain DABCYL.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Corning
Description:   L-glutamine is an essential amino acid and a key component of culture media, serving as a major energy source for propagating cells. It is very stable as a dry powder and as a frozen solution but degrades rapidly in liquid media or stock solutions, producing toxic compounds. Optimal cell performance usually requires supplementation of the media with L-glutamine prior to use. This formulation is prepared in cell culture grade water.
Supplier:  REVACC INC
Description:   A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2), Wuhan-Hu-1 (GenBank: MN908947) was produced by human embryonic kidney HEK293F cells, followed by purification.

Supplier:  LGC STANDARDS
Description:   2-Amino-4-chlorophenol, TRC, LGC Standards
New Product
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Light green SF yellowish, pure, high purity biological stain
Supplier:  AMBEED, INC
Description:   (R)-2-Aminopent-4-enoic acid hydrochloride, Purity: 97%, CAS Number: 108412-04-0, Appearance: Form: Crystal - Powder / Colour: White - Slightly pale yellow red, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   Fmoc-N-Me-D-Leu-OH 97%
Supplier:  Corning
Description:   L-glutamine is an essential amino acid and a key component of culture media, serving as a major energy source for propagating cells. It is very stable as a dry powder and as a frozen solution but degrades rapidly in liquid media or stock solutions, producing toxic compounds. Optimal cell performance usually requires supplementation of the media with L-glutamine prior to use. This formulation is prepared in cell culture grade water.
Catalog Number: (77561-092)

Supplier:  Sino Biological
Description:   The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
New Product
Supplier:  Thermo Scientific Chemicals
Description:   N-Fmoc-N-methyl-D-leucine, 97%
MSDS SDS
Supplier:  Invitrogen
Description:   The Pierceâ„¢ Dimethylsulfoxide (DMSO) is a sequencing-grade preparation with high purity for use in traditional amino acid analyzers and other high-volume applications.
MSDS SDS
Supplier:  Biotium
Description:   This MAb recognizes granulocyte-colony stimulating factor (G-CSF) in the cytoplasm of mature granulocytes. It shows no reactivity with any other cell types. Markers of myeloid cells are useful in the identification of different levels of cellular differentiation. It reacts with early precursor and mature forms of myeloid cells. It is useful for the detection of myeloid leukemias and granulocytic sarcomas. It can be used as a marker of granulocytes in normal tissues or inflammatory processes.G-CSF is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. The human G-CSF cDNA encodes a 207 amino acid precursor containing a 29 amino acid signal peptide that is proteolytically cleaved to form a 178 amino acid residue mature protein. Two G-CSF's, which are identical except for a three amino acid deletion in the amino-terminus of one form of the protein have been isolated from human cells. Murine and human G-CSF's share 73% sequence identity at the amino acid level.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041479-25G , MDL Number: MFCD01320855
Supplier:  ALADDIN SCIENTIFIC
Description:   2-Aminoterephthalic acid can be used to synthesize:· Lanthanide coordination polymers with 1,10-phenanthroline by hydrothermal method.· Blue-emitting derivatives of 2-aminoterephthalic acid.· Amino-functionalized Zr-terephthalate (UiO-66), an excellent catalyst for selective synthesis of jasminaldehyde.· IRMOF-3, a zinc aminoterephthalate metal-organic framework useful as a catalyst for the Knoevenagel condensation of benzaldehyde and ethyl cyanoacetate.· Polymeric composite membrane with excellent CO2 separation capabilities.
New Product
Supplier:  AMBEED, INC
Description:   N2,Nd,Nw-tris(tert-butoxycarbonyl)-L-arginine 95%
Supplier:  MilliporeSigma
Description:   L-3,3'',5-Triiodothyronine, Free Acid, High Purity. (T3). Beige solid. PROTECT FROM LIGHT. Chromatographically purified. Purity: >= 99% by HPLC. Soluble in 100 mM NaOH. RTECS AY6750000, CAS 6893-02-3, M.W. 651.0.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,361 - 3,376  of 142,781