Text Search >
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Print…
You Searched For:
173,766 results were found
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Supplier:
AMBEED, INC
Description:
4-((N-Benzyl-8-chloro-1-methyl-1,4-dihydrochromeno[4,3-c]pyrazole-3-carboxamido)methyl)benzoic acid, Purity: 95%, CAS Number: 1773489-72-7, Appearance: Solid, Storage: Sealed in dry, Store in freezer, under -20C, Size: 1MG
Catalog Number:
(103003-050)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Catalog Number:
(TCL0141-001G)
Supplier:
TCI America
Description:
[as an indicator for assay of Food Yellow No.4 (Tartrazine)]
CAS Number: 5141-20-8 MDL Number: MFCD00012121 Molecular Formula: C37H36N2O9S3 Molecular Weight: 792.84 Form: Crystal Color: Red
Catalog Number:
(10257-530)
Supplier:
Bioss
Description:
Semaphorins are a family of cell surface and secreted proteins that are conserved from insects to humans. Members of this family of proteins are approximately 750 amino acids in length (including signal sequences) and are defined by a conserved extracellular “semaphorin†domain of approximately 500 amino acids containing 14-16 cysteines, blocks of conserved sequences and no obvious repeats. The transmembrane semaphorins are characterized by an additional 80 amino acid transmembrane domain and an 80-110 amino acid cytoplasmic domain. Secreted and cell-bound semaphorins chemically attract and repel the growth of neural axons, guiding the development of intricate networks of neural tissue. SEMA4B (semaphorin-4B), also known as SemC or SEMAC, is an 832 amino acid single-pass type I membrane protein that belongs to the semaphorin family and exists as two alternatively spliced isoforms. Containing one Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a single sema domain, SEMA4B is encoded by a gene located on human chromosome 15.
Catalog Number:
(103007-536)
Supplier:
Anaspec Inc
Description:
This is amino acids 93 to 105 fragment of human leptin (anti-obesity protein). Leptin is a 167-amino acid plasma protein that is synthesized in adipose tissue and acts as a blood-borne hormone responsible for weight maintenance.
Sequence: NVIQISNDLENLR MW: 1527.7 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(103003-048)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
Spectrum Chemicals
Description:
(1,2-Cyclohexylenedinitrilo)tetraacetic Acid, Reagent is an alkyl-substituted amino acid that functions as a chelating agent. This ingredient's source is synthetic. It appears as a solid and is partially soluble in cold water. Its reagent grade means this is the highest quality commercially available for this chemical and that the American Chemical Society has not officially set any specifications for this material.
Supplier:
Adipogen
Description:
AMCA-X SE is an amine-reactive, UV-excitable, blue fluorescent dye.
Catalog Number:
(TS25430-0010)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
D-(-)-Cysteine 99%
Supplier:
AMBEED, INC
Description:
Cephalexin monohydrate ≥98%
Catalog Number:
(76116-114)
Supplier:
Bioss
Description:
AARE (Acylamino-acid-releasing enzyme) is also known as Acyl-peptide hydrolase. It catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus corresponding to the protein are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
Catalog Number:
(EM8.01246.0050)
Catalog Number:
(10361-034)
Supplier:
Bioss
Description:
Glycophorins A, B and C are sialoglycoproteins of the human erythrocyte membrane, which bear the antigenic determinants for the MN, Ss and Gerbich blood groups, respectively. Glycophorins span the membrane once and present their amino-terminal end to the extracellular surface of the human erythrocyte. The genetic array of expressed glycophorin surface antigens on erythrocytes defines the blood group phenotype of the individual. The human Glycophorin A gene maps to chromosome 4q31.21, contains seven exons which are 97% homologous to Glycophorin B, and encodes a 150 amino acid protein. The human Glycophorin B gene maps to chromosome 4q31.21 and encodes a 91 amino acid protein. The human Glycophorin C gene maps to chromosome 2q14.3 and contains four exons. Glycophorin C transcript can generate two protein isoforms. Isoform 1 includes all 4 exons and encodes the full length 128 amino acid protein. Isoform 2 is missing exon 2 and encodes a 109 amino acid protein, which specifies the Yus subtype of the Gerbich phenotype.
Catalog Number:
(10361-032)
Supplier:
Bioss
Description:
Glycophorins A, B and C are sialoglycoproteins of the human erythrocyte membrane, which bear the antigenic determinants for the MN, Ss and Gerbich blood groups, respectively. Glycophorins span the membrane once and present their amino-terminal end to the extracellular surface of the human erythrocyte. The genetic array of expressed glycophorin surface antigens on erythrocytes defines the blood group phenotype of the individual. The human Glycophorin A gene maps to chromosome 4q31.21, contains seven exons which are 97% homologous to Glycophorin B, and encodes a 150 amino acid protein. The human Glycophorin B gene maps to chromosome 4q31.21 and encodes a 91 amino acid protein. The human Glycophorin C gene maps to chromosome 2q14.3 and contains four exons. Glycophorin C transcript can generate two protein isoforms. Isoform 1 includes all 4 exons and encodes the full length 128 amino acid protein. Isoform 2 is missing exon 2 and encodes a 109 amino acid protein, which specifies the Yus subtype of the Gerbich phenotype.
Supplier:
BeanTown Chemical
Description:
CAS: 74-79-3; EC No: 200-811-1; MDL No: MFCD00002635; RTECS: CF1934200
Crystalline/Powder; Molecular Formula: C6H14N4O2; MW: 174.20
Melting Point: 222° (decomposes)
Air Sensitive
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
