Text Search >
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Print…
You Searched For:
174,388 results were found
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Catalog Number:
(103003-050)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Catalog Number:
(EM8.14986.0050)
Supplier:
PeproTech, Inc.
Description:
SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1β protein, produced by an N-terminal truncation of two additional amino acids, after removal of the signal sequence, contains 72 amino acid residues. Recombinant Rat SDF-1β (CXCL12) is an 8.4 kDa protein containing 72 amino acid residues.
Catalog Number:
(103003-048)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042563-5G , MDL Number: MFCD00173011
Catalog Number:
(10257-530)
Supplier:
Bioss
Description:
Semaphorins are a family of cell surface and secreted proteins that are conserved from insects to humans. Members of this family of proteins are approximately 750 amino acids in length (including signal sequences) and are defined by a conserved extracellular “semaphorin†domain of approximately 500 amino acids containing 14-16 cysteines, blocks of conserved sequences and no obvious repeats. The transmembrane semaphorins are characterized by an additional 80 amino acid transmembrane domain and an 80-110 amino acid cytoplasmic domain. Secreted and cell-bound semaphorins chemically attract and repel the growth of neural axons, guiding the development of intricate networks of neural tissue. SEMA4B (semaphorin-4B), also known as SemC or SEMAC, is an 832 amino acid single-pass type I membrane protein that belongs to the semaphorin family and exists as two alternatively spliced isoforms. Containing one Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a single sema domain, SEMA4B is encoded by a gene located on human chromosome 15.
Catalog Number:
(TS25430-0010)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
D-(-)-Cysteine 99%
Catalog Number:
(76839-170)
Supplier:
AMBEED, INC
Description:
H-D-Asp(OMe)-OH·HCl 97%
Supplier:
BeanTown Chemical
Description:
CAS: 74-79-3; EC No: 200-811-1; MDL No: MFCD00002635; RTECS: CF1934200
Crystalline/Powder; Molecular Formula: C6H14N4O2; MW: 174.20
Melting Point: 222° (decomposes)
Air Sensitive
Supplier:
Spectrum Chemicals
Description:
(1,2-Cyclohexylenedinitrilo)tetraacetic Acid, Reagent is an alkyl-substituted amino acid that functions as a chelating agent. This ingredient's source is synthetic. It appears as a solid and is partially soluble in cold water. Its reagent grade means this is the highest quality commercially available for this chemical and that the American Chemical Society has not officially set any specifications for this material.
Catalog Number:
(76116-114)
Supplier:
Bioss
Description:
AARE (Acylamino-acid-releasing enzyme) is also known as Acyl-peptide hydrolase. It catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus corresponding to the protein are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
Supplier:
AMBEED, INC
Description:
Cephalexin monohydrate ≥98%
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 041511-1G , MDL Number: MFCD02682475
Catalog Number:
(77674-146)
Supplier:
AMBEED, INC
Description:
DL-Homocysteine ≥98%
Catalog Number:
(10297-802)
Supplier:
Bioss
Description:
The fidelity of protein synthesis requires efficient discrimination of amino acid substrates by aminoacyl-tRNA synthetases. Aminoacyl-tRNA synthetases function to catalyze the aminoacylation of tRNAs by their corresponding amino acids, thus linking amino acids with tRNA-contained nucleotide triplets. ProRS (Prolyl-tRNA synthetase), also known as EPRS, EARS, PARS, QARS, QPRS, PIG32 or GLUPRORS, is a 1,512 amino acid protein that contains three WHEP-TRS domains and belongs to both the class-I and class-II aminoacyl-tRNA synthetase family. Functioning as a component of the multisynthase complex, ProRS uses ATP to catalyze the conversion of L-glutamate and tRNA(Glu) to L-glutamyl-tRNA(Glu), as well as the conversion of L-proline and tRNA(Pro) to L-prolyl-tRNA(Pro).
Supplier:
Matrix Scientific
Description:
MF=C11H13NO5 MW=239.23 CAS=6081-61-4 MDL=MFCD00063144 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
