Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-Amino-3,5-dibromopyridine


95,390  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"95390"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Strem Chemicals Inc
Description:   Metal TMHD
Supplier:  AMBEED, INC
Description:   2-[Bis(2,4-di-tert-butyl-phenoxy)phosphinooxy]-3,5-di(tert-butyl)phenyl-palladium(II) chloride dimer, Purity: 98%, CAS Number: 217189-40-7, Appearance: White to Pale-green to Gray Powder or crystals, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Petroleum spirit, 35…60 °C ACS
New Product
Supplier:  TCI America
Description:   [NH2Me2][(RuCl((R)-xylbinap))2(u-Cl)3], CAS Number: 944451-08-5, MF: C106H104Cl5NP4Ru2, MW: 1895.29, Synonyms: Dimethylammonium Dichlorotri(u-chloro)bis[(R)-(+)-2,2-bis[di(3,5-xylyl)phosphino]-1,1-binaphthyl]diruthenate(II), Size: 200MG
MSDS SDS
Catalog Number: (AAJ66808-MCR)

Supplier:  Thermo Scientific Chemicals
Description:   b (25-35)
Supplier:  TCI America
Description:   4-Chloroquinoline, Purity: >97.0%(GC), CAS Number: 611-35-8, Molecular Formula: C9H6ClN, Molecular Weight: 163.60, Size: 5G
Supplier:  Matrix Scientific
Description:   MF=C14H21NO4 MW=267.33 CAS=86770-31-2 MDL=MFCD02179394 10G
Supplier:  TCI America
Description:   CAS Number: 182250-68-6
MDL Number: MFCD02093439
Molecular Formula: C40H44O4Si2
Molecular Weight: 644.96
Form: Clear Liquid
Color: Colorless
MSDS SDS
Supplier:  AMBEED, INC
Description:   (5aS,10bR)-2-(3,5-Bis(trifluoromethyl)phenyl)-4,5a,6,10b-tetrahydroindeno[2,1-b][1,2,4]triazolo[4,3-d][1,4]oxazin-2-ium tetrafluoroborate, Purity: 98%, CAS Number: 1214711-40-6, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 100MG
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis[3,5-bis(trifluoromethyl)phenyl]-5,5',6,6',7,7',8,8'-octahydro-1,1'-binaphthyl-2,2'-diyl Hydrogen Phosphate, Purity: 98%, CAS Number: 2229836-07-9, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   Clofazimine 98%
Supplier:  AMBEED, INC
Description:   1-(3,5-Difluorophenyl)-2,2,2-trifluoroethanone, Purity: 97%, CAS number: 845823-12-3, Appearance: Solid or liquid, Storage: Sealed in dry, 2-8C, Size: 10G
Supplier:  Thermo Scientific Chemicals
Description:   98% 100G
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   1G
MSDS SDS
Catalog Number: (103007-366)

Supplier:  Anaspec Inc
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 029880-500MG , MDL Number: MFCD00173770
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,313 - 5,328  of 95,390