Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

(3R,6R)-6-Methylpiperidine-3-carboxylic acid hydrochloride


33,994  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   The PI4KB / PI4KIII beta Antibody (3B1) from Novus Biologicals is a mouse monoclonal antibody to PI4KB / PI4KIII beta. This antibody reacts with human. The PI4KB / PI4KIII beta Antibody (3B1) has been validated for the following applications: Western Blot, ELISA.
Catalog Number: (103647-624)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human TNF-beta / TNFSF1 / Lymphotoxin alpha (rh TNF-beta / TNFSF1 / Lymphotoxin alpha; Catalog#10270-HNAE; P01374; Leu 35-Leu 205). TNF-beta / TNFSF1 / Lymphotoxin alpha specific IgG was purified by Human TNF-beta / TNFSF1 / Lymphotoxin alpha affinity chromatography.
Catalog Number: (103283-236)

Supplier:  Novus Biologicals
Description:   The LXR beta / NR1H2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LXR beta / NR1H2. This antibody reacts with human. The LXR beta / NR1H2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number: (103620-046)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human IFNB1 / IFN-beta / Interferon beta (rh IFNB1 / IFN-beta / Interferon beta; Catalog#10704-HNAS; P01574; Met1-Asn187). Total IgG was purified by Protein A affinity chromatography.

Supplier:  Genetex
Description:   Mouse Monoclonal antibody [B894M] to Interferon beta

Supplier:  AFG BIOSCIENCE LLC
Description:   Human HSPb2 (Heat Shock Protein Beta 2) ELISA Kit
Catalog Number: (77074-596)

Supplier:  ANTIBODIES.COM LLC
Description:   Goat polyclonal antibody to LXR beta for ELISA, IF and Flow Cytometry with samples derived from Human.
Catalog Number: (10168-564)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta COP
Supplier:  Anaspec Inc
Description:   Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (89349-450)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta Tubulin 4 (tubulin, beta 4)
Catalog Number: (89355-498)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)
Catalog Number: (89356-372)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta Actin (actin, beta)
Catalog Number: (76174-514)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.
Catalog Number: (89357-672)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to AChR beta 2

Supplier:  Novus Biologicals
Description:   The PI4KB / PI4KIII beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI4KB / PI4KIII beta. This antibody reacts with human. The PI4KB / PI4KIII beta Antibody has been validated for the following applications: Western Blot.
Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The H57-597 monoclonal antibody is specific for the beta chain of the mouse T cell Receptor (TCR). The crosslinking induces activation and proliferation of T cells, as a plate-bound or a soluble H57-597, or the plate-bound antibody can induce apoptosis, based on assay conditions. The beta chain of the TCR can combine with the alpha chain of the receptor to produce the alpha-beta TCR, which is expressed by the NKT cells, by the NK1.1+ thymocytes and most of the T cells. The beta chain does not react with the gamma-delta TCR-bearing cells, expressed by a small number of T cells. This antibody can be used as a phenotypic marker for the TCR beta expressing cells or for the functional purpose of TCR-mediated cell activation or apoptosis.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
321 - 336  of 33,994