Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

6-Bromoimidazo[1,2-a]pyridin-2-amine


164,172  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"164172"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bioss
Description:   The leucine-rich (LRR) repeat is a 20-30 amino acid motif that forms a hydrophobic Alpha/Beta horseshoe fold, allowing it to accommodate several leucine residues within a tightly packed core. All LRR repeats contain a variable segment and a highly conserved segment, the latter of which accounts for 11 or 12 residues of the entire LRR motif. LRRTM1 (leucine rich repeat transmembrane neuronal 1) is a 522 amino acid single-pass type I membrane protein that localizes to the endoplasmic reticulum and contains ten LRR repeats. Expressed predominately in forebrain tissue, LRRTM1 is thought to be involved in the development of forebrain structures, specifically by influencing axon trafficking, as well as neuronal differentiation and connectivity. Human LRRTM1 shares 96% amino acid identity with its mouse counterpart, suggesting a conserved role between species. Defects in the gene encoding LRRTM1 may be associated with the pathogenesis of several common neurodevelopmental disorders.
Catalog Number: (10116-764)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: SNX16 antibody was raised against a 13 amino acid synthetic peptide near the N-Terminus of SNX16; Application: ELISA, Western Blot
Catalog Number: (10113-224)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: ARG1 antibody was raised against a 15 amino acid synthetic peptide near the C-Terminus of ARG1, Tested Applications: ELISA, WB
Catalog Number: (10113-936)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: NUAK1 antibody was raised against a 15 amino acid synthetic peptide near the internal region of NUAK1, Tested Applications: ELISA
Catalog Number: (10114-506)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: TERF2IP antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of TERF2IP; Applications: ELISA,Western blotting
Catalog Number: (10112-044)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: PEBP1 antibody was raised against a 14 amino acid synthetic peptide near the internal region of PEBP1, Application: ELISA, WB, IHC
Catalog Number: (10115-102)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: KLHDC8B Antibody was raised against a 12 amino acid sequence near the internal region of KLHDC8B; Applications: ELISA,Western blotting
Catalog Number: (10113-050)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: DMP1 antibody was raised against a 12 amino acid synthetic peptide near the internal region of DMP1, Application: ELISA, WB
Supplier:  PeproTech, Inc.
Description:   All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. The GRO proteins chemoattract and activate neutrophils and basophils. Recombinant Rat GRO/KC (CXCL1) is a 7.8 kDa protein consisting of 72 amino acids, including the 'ELR' motif common to the CXC chemokine family that binds to CXCR1 or CXCR2.
Supplier:  PeproTech, Inc.
Description:   All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. The GRO proteins chemoattract and activate neutrophils and basophils. Recombinant Rat GRO-β/MIP-2 (CXCL2) is a 7.9 kDa protein consisting of 73 amino acids, including the ‘ELR’ motif common to the CXC chemokine family that binds to CXCR1 or CXCR2.
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-p-fluoro-Phe-OH
Catalog Number: (10112-554)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: ELMO3 antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of ELMO3, Application: ELISA, WB
Catalog Number: (10112-510)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: DUSP8 antibody was raised against a 14 amino acid synthetic peptide near the N-Terminus of DUSP8, Application: ELISA, WB
Catalog Number: (10115-212)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: Ryk antibody was raised against a 13 amino acid peptide near the internal region of Ryk (mouse); Applications: ELISA,Western blotting
Catalog Number: (10234-132)

Supplier:  Bioss
Description:   C Peptide is part of the molecule of Proinsulin, that consists of three parts: C Peptide and two long strands of amino acids (called the alpha and beta chains) that later become linked together to form the insulin molecule. From every molecule of proinsulin, one molecule of insulin plus one molecule of C Peptide are produced. C peptide is released into the blood stream in equal amounts to insulin. A test of C peptide levels will show how much insulin the body is making. Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Supplier:  Anaspec Inc
Description:   This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16  of 164,172