Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Amino-5-methoxybenzenesulphonic+acid


163,269  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163269"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (TS40118-0250)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Methyl blue, pure, certified
Supplier:  LGC STANDARDS
Description:   (2S,3aS,7aS)-1-[(2S)-2-[[(1S)-1-Carboxybutyl]amino]propanoyl]octahydro-1H-indole-2-carboxylic Acid (Perindoprilat), Mikromol, LGC Standards
New Product
Supplier:  AMBEED, INC
Description:   Cephalexin monohydrate ≥98%
New Product
Supplier:  Thermo Scientific Chemicals
Description:   White to off-white
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 020432-500MG , MDL Number: MFCD04341427
Supplier:  Matrix Scientific
Description:   MF=C11H13NO5 MW=239.23 CAS=6081-61-4 MDL=MFCD00063144 5G
Supplier:  AMBEED, INC
Description:   (R)-3-(Benzo[b]thiophen-3-yl)-2-((tert-butoxycarbonyl)amino)propanoic acid, Purity: 95%, CAS number: 111082-76-9, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1G
Catalog Number: (103003-050)

Supplier:  Anaspec Inc
Description:   Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  Spectrum Chemicals
Description:   (1,2-Cyclohexylenedinitrilo)tetraacetic Acid, Reagent is an alkyl-substituted amino acid that functions as a chelating agent. This ingredient's source is synthetic. It appears as a solid and is partially soluble in cold water. Its reagent grade means this is the highest quality commercially available for this chemical and that the American Chemical Society has not officially set any specifications for this material.
Small Business Enterprise
Catalog Number: (76818-326)

Supplier:  AMBEED, INC
Description:   2-Amino-3-(7H-pyrrolo[2,3-b]pyridin-3-yl)propanoic acid, Purity: 98%, CAS Number: 7303-50-6, Appearance: Solid, Storage: Keep in dark place, Sealed in dry, Store in freezer, under -20C, Size: 100MG
Supplier:  Chem Impex International
Description:   Reagent for the preparation of Boc-amino acids and peptides in high yields.
MSDS SDS

Supplier:  United Scientific Supplies
Description:   These large and colorful DNA, mRNA, ribosome, tRNA, and amino acid models are visible anywhere in the classroom.
Catalog Number: (103003-048)

Supplier:  Anaspec Inc
Description:   Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier:  Bioss
Description:   Semaphorins are a family of cell surface and secreted proteins that are conserved from insects to humans. Members of this family of proteins are approximately 750 amino acids in length (including signal sequences) and are defined by a conserved extracellular “semaphorin” domain of approximately 500 amino acids containing 14-16 cysteines, blocks of conserved sequences and no obvious repeats. The transmembrane semaphorins are characterized by an additional 80 amino acid transmembrane domain and an 80-110 amino acid cytoplasmic domain. Secreted and cell-bound semaphorins chemically attract and repel the growth of neural axons, guiding the development of intricate networks of neural tissue. SEMA4B (semaphorin-4B), also known as SemC or SEMAC, is an 832 amino acid single-pass type I membrane protein that belongs to the semaphorin family and exists as two alternatively spliced isoforms. Containing one Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a single sema domain, SEMA4B is encoded by a gene located on human chromosome 15.
Supplier:  Thermo Scientific Chemicals
Description:   99.5+%.Powder,CAUTION: May be harmful if swallowed,1kg,250g.
MSDS SDS
Supplier:  MilliporeSigma
Description:   Cas Number: 5141-20-8, 100G
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,937 - 5,952  of 163,269