Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Bromo-3,6-dimethoxybenzoic+acid


176,331  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"176331"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C8H5N3O3 MW=191.15 CAS=677702-36-2 MDL=MFCD07781436 10G
Supplier:  MilliporeSigma
Supplier:  TCI America
Description:   [Hydroxyl Protecting Agent]
CAS Number: 40615-36-9
MDL Number: MFCD00008409
Molecular Formula: C21H19ClO2
Molecular Weight: 338.83
Purity/Analysis Method: >97.0% (HPLC,T)
Form: Crystal
Melting point (°C): 125
MSDS SDS
Supplier:  Corning
Description:   Borosilicate glass with side arms, non sterile.
Product available on GSA Advantage®
Supplier:  AMBEED, INC
Description:   3-Fluorocyclobutanamine hydrochloride, Purity: 97%, CAS Number: 1284245-36-8, Appearance: White to Yellow Solid, Storage: Inert atmosphere, 2-8 C, Size: 250mg
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 4815-36-5, MDL: MFCD00126391
MSDS SDS
Supplier:  VWR International
Description:   VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.
Supplier:  Anaspec Inc
Description:   GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   (R)-3-Cyclohexylmorpholine, Purity: 95+%, CAS number: 1269969-36-9, Appearance: Liquid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1G
Supplier:  TCI America
Description:   CAS Number: 13431-36-2 MDL Number: MFCD00025144 Molecular Formula: C4H11N3S Molecular Weight: 133.21 Form: Crystal Color: White Melting point (°C): 97
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 4387-36-4
Molecular Formula: C7H4IN
Molecular Weight: 229.02
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 147
Melting point (°C): 55
MSDS SDS
Catalog Number: (470301-188)

Supplier:  Ward's Science
Description:   CAS Number: Mixture
Density: 1.0 g/mL
Boiling Point: 100 °C
Freezing Point: 0 °C
Synonyms: Iodine-Potassium Iodide Solution, IKI, Iodine-Iodine, Iodine Solution, Iodine Lugol's Dilute, and Iodine 2%
Shelf Life: 36 Months
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 108-36-1
MDL Number: MFCD00000078
Molecular Formula: C6H4Br2
Molecular Weight: 235.91
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 219
Melting point (°C): -7
Flash Point (°C): 94
Specific Gravity (20/20): 1.96
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 3087-36-3
MDL Number: MFCD00009071
Molecular Formula: C8H20O4Ti
Molecular Weight: 228.11
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 236
Flash Point (°C): 28
Specific Gravity (20/20): 1.09
MSDS SDS
Supplier:  Strem Chemicals Inc
Description:   Phosphine
Supplier:  AMBEED, INC
Description:   6-tert-Butyl 3-ethyl 4,5-dihydro-1H-pyrazolo[3,4-c]pyridine-3,6(7H)-dicarboxylate 95%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,961 - 4,976  of 176,331