Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Bromo-3,6-dimethoxybenzoic+acid


175,766  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"175766"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Disodium uridine-5-monophosphate, Purity: 98%, CAS number: 3387-36-8, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 5G
Supplier:  AAT BIOQUEST INC
Description:   6-TAMRA is the purified single isomer of 5(6)-TAMRA.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  TCI America
Description:   Ethyl 6-Methyl-2-oxo-4-phenyl-1,2,3,4-tetrahydropyrimidine-5-carboxylate, Purity: >98.0%(HPLC)(N), CAS Number: 5395-36-8, Molecular Formula: C14H16N2O3, Synonym: 6-Methyl-2-oxo-4-phenyl-1,2,3,4-tetrahydropyrimidine-5-carboxylic Acid Ethyl Ester, Form: Crystal-Powder, Size: 200MG
MSDS SDS
Supplier:  TCI America
Description:   3-Hydroxyphenyl Benzoate, Purity: >95.0%(GC), CAS number: 136-36-7, Molecular Formula: C13H10O3, MW: 214.22, Synonym: Benzoic Acid 3-Hydroxyphenyl Ester, Resorcinol Monobenzoate, Physical state: Solid, Form: Crystal - Powder, Colour: White - Reddish yellow, Size: 25G
MSDS SDS
Supplier:  TCI America
Description:   Ethyl 5-Fluoroindole-2-Carboxylate, Purity: >98.0%(GC), Cas no: 348-36-7, Molecular formula : C11H10FNO2, Molecular weight : 207.20, Synonyms: 5-Fluoroindole-2-carboxylic Acid Ethyl Ester, Size: 1G
Catalog Number: (103006-340)

Supplier:  Anaspec Inc
Description:   This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.
Sequence:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
MW:4195.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   5-((6-Chloro-5-(1-methyl-1H-indol-5-yl)-1H-benzo[d]imidazol-2-yl)oxy)-2-methylbenzoic acid, Purity: 95%, CAS Number: 1219739-36-2, Appearance: Solid, Storage: Sealed in dry, 2-8C, Size: 25MG
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   Certificate of lot analysis provided.
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 3387-36-8; EC No: 222-211-9; MDL No: MFCD00006525; RTECS: YU7975000 Solid; Molecular Formula: C9H11N2O9P; MW: 368.14 Melting Point: 209° (decomposes)
MSDS SDS

Supplier:  AOB CHEM USA
Description:   Potassium (4-cyanophenyl)trifluoroborate ≥95%
Supplier:  LGC STANDARDS
Description:   (3R,6R)-3,6-Diphenyl-2,5-piperazinedione, TRC, LGC Standards
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 037808-500MG , MDL Number: MFCD03450746

Supplier:  Enzo Life Sciences
Description:   Mitochondria dye
Supplier:  Air Control
Description:   Corrosion-resistant casework cabinets are constructed of stress-relieved, acid-resistant, 1.3 cm (½") thick polypropylene.
Supplier:  Thermo Scientific Chemicals
Description:   Marker dye for RNA useful in acid buffer systems
MSDS SDS
Supplier:  AMBEED, INC
Description:   Potassium (4-cyanophenyl)trifluoroborate 97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
977 - 992  of 175,766
Prev   62  63  64  65  66  67  68  69  70  71  72  73  74  75  76  77  Next