Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"32536"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 64838-55-7
MDL Number: MFCD01860852
Molecular Formula: C11H17NO4S
Molecular Weight: 259.32
Purity/Analysis Method: >90.0% (T)
Form: Crystal
Specific rotation [a]20/D: -160 deg (C=1, MeOH)
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 152120-55-3, MDL: MFCD02683516
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C6H6N2O2 MW=138.13 CAS=5521-55-1 MDL=MFCD00068241 100G
Catalog Number: (103007-612)

Supplier:  Anaspec Inc
Description:   Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   MF=C14H26N2O2 MW=254.38 Cas=189333-03-7 ,500Mg
Catalog Number: (77126-182)

Supplier:  Prosci
Description:   HIP-55 Peptide
Supplier:  AMBEED, INC
Description:   6-Oxa-5-thia-4-azaspiro[2.4]heptane 5,5-dioxide, N-BOC protected ≥98%
New Product
Supplier:  TCI America
Description:   CAS Number: 1477-55-0
MDL Number: MFCD00008119
Molecular Formula: C8H12N2
Molecular Weight: 136.20
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 248
Flash Point (°C): 134
Freezing point (°C): 14
Specific Gravity (20/20): 1.05
MSDS SDS
Supplier:  Electron Microscopy Sciences
Description:   These tweezers have an anti-magnetic WA1 handle with replaceable 55-STD tips.
Supplier:  TCI America
Description:   CAS Number: 3105-55-3
MDL Number: MFCD00070246
Molecular Formula: C4H4O4
Molecular Weight: 138.05
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 063538-500MG , MDL Number: MFCD00128469
Supplier:  Matrix Scientific
Description:   MF=C14H12O4 MW=244.25 CAS=92254-55-2 MDL=MFCD08705866 1G
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 063545-500MG , MDL Number: MFCD00156401
Supplier:  AMBEED, INC
Description:   4,4'-(Ethyne-1,2-diyl)dibenzaldehyde, Purity: 98%, CAS Number: 84907-55-1, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  AMBEED, INC
Description:   1-(3-Fluorophenyl)cyclopropanecarbonitrile, Purity: 95%, CAS Number: 124276-55-7, Appearance: Liquid or solid, Storage: Sealed in dry, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   5-(Trifluoromethyl)indoline, Purity: 97%, CAS Number: 162100-55-2, Appearance: Solid or liquid, Storage: Keep in dark place, Sealed in dry, 2-8 C, Size: 250mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,801 - 2,816  of 32,536