Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(7-Azabenzotriazol-1-yloxy)tri(1-pyrrolidinyl)phosphonium+hexaflu


22,352  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22352"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 012564-1G , MDL Number: MFCD06245507

Supplier:  MAPA
Description:   These gloves are designed for applications handling liquid nitrogen and other cryogenic gases, to protect from cold contact and prevent burns from liquid gas leakage.
Catalog Number: (AAAL12862-14)

Supplier:  Thermo Scientific Chemicals
Description:   Bismaleimide Bis(4-maleimidophenyl)methane 1,1'-(Methylenedi-4,1-phenylene)bismaleimide. Grade: 95. Melting Point C156-158*. Boiling Point C: NA. C21H14N2O4. 13676-54-5. TOXIC IRRITANT
MSDS SDS

Supplier:  Prosci
Description:   Recombinant Streptavidin Protein (from <i>E. coli</i>)
Supplier:  AMBEED, INC
Description:   Methyl octanoate, Purity: 98%, CAS Number: 111-11-5, Appearance: Form: liquid, Colour: colourless, Storage: Sealed in dry, Room Temperature, Size: 100g
Catalog Number: (103003-158)

Supplier:  Anaspec Inc
Description:   Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AOB CHEM USA
Description:   Ethyl 7-methyl-α-oxobenzo[b]thiophene-2-acetate ≥95%
New Product
Supplier:  AMBEED, INC
Description:   (2R,3S,4R,5R,8R,10R,11R,12S,13S,14R)-11-(((2S,3R,4S,6R)-4-(Dimethylamino)-3-hydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-2-ethyl-3,4,10-trihydroxy-13-(((2R,4R,5S,6S)-5-hydroxy-4-methoxy-4,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-3,5,8,10,12,14-hexamethyl-1-oxa-6-azacyclopentadecan-15-one ≥97%
New Product
Supplier:  AMBEED, INC
Description:   3-(1-((3,3-Diphenylpropyl)(methyl)amino)-2-methylpropan-2-yl) 5-methyl 2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate hydrochloride, Purity: 99%, CAS Number: 132866-11-6, Appearance: Slightly pale yellow to Yellow Crystal or Powder, Storage: Inert atmosphere, 2-8C, Size: 100MG
Supplier:  AMBEED, INC
Description:   4-Ethylphenylacetylene 98%
Supplier:  AOB CHEM USA
Description:   3-Chloro-2,4-dimethylphenylboronic acid ≥97%
Supplier:  Matrix Scientific
Description:   5-(Anilinocarbonyl)-1-methyl-1H-pyrazole-4-carboxylic acid
Catalog Number: (89355-760)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Eg5 (kinesin family member 11)
Supplier:  AMBEED, INC
Description:   3-(4-Bromophenyl)propan-1-ol, Purity: 98%, CAS Number: 25574-11-2, Appearance: Colorless to yellow liquid or solid, Storage: Sealed in dry, Room Temperature, Size: 10g
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00005872 Beilstein Registry No.: 373934 Soluble in alcohol and aqueous solutions of alkali; sparingly soluble in water
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 3396-11-0; EC No: 222-248-0; MDL No: MFCD00013056 Crystalline/Powder; Linear Formula: CsOOCCH3; MW: 191.95 Melting Point: 194° Hygroscopic
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,481 - 8,496  of 22,352