Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"74817"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103007-114)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 031146-500MG , MDL Number: MFCD08556202
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Alizarin red S (sodium salt), pure, certified
Supplier:  Biolegend
Description:   APC anti-mouse IL-22 [Poly5164]; Isotype: Goat Polyclonal IgG; Reactivity: Mouse; Apps: ICFC; Size: 100 tests
Supplier:  MP Biomedicals
Description:   Alizarin red S is used in a biochemical assay to determine, quantitatively by colorimetry, the presence of calcific deposition by cells of an osteogenic lineage.
MSDS SDS

Supplier:  Bioss
Description:   The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.

Supplier:  Bioss
Description:   Members of the BAGE gene family encode antigens that are recognized by cytotoxic T lymphocytes and are also known as CT (cancer/testis) antigens. Generated by juxtacentromeric shuffling of the MLL3 gene, the ancestral BAGE gene was expanded by acrocentric exchanges and/or juxtacentromeric movements.Generally, BAGE proteins are silent in all normal tissues with the exception of testis. BAGE2 and BAGE 3 (B melanoma antigen 2 and 3, respectively), also known as Cancer/testis antigen 2.2 and 2.3 (respectively), are 109 amino acid secreted proteins that are expressed in 22% of melanomas, lung and bladder carcinomas, and are also expressed in normal testis tissue. Like the genes encoding MAGE proteins, BAGE genes are most likely silenced by DNA methylation and/or chromatin compaction in normal tissues other than testis.
Supplier:  MP Biomedicals
Description:   Bis-Tris is a zwitterionic buffer; an amine buffer similar to Tris Hydrochloric acid that exhibits only a very small shift in dissociation constant with respect to temperature. It is structurally analogous to the the Good buffers that were developed to provide buffers in the pH range of 6.15 - 8.35 for wide applicability to biochemical studies.
Supplier:  BeanTown Chemical
Description:   CAS: 84348-38-9; MDL No: MFCD01861787 Solid; Molecular Formula: C11H17NO4; MW: 227.26 Melting Point: 110-115° Optical Rotation: [α]22/D -58°, c = 0.5 in chloroform Light Sensitive
MSDS SDS
Supplier:  Surmodics
Description:   The ABTS (2,2’-azino-bis [3-ethylbenzthiazoline-6-sulfonic acid]) substrate is supplied as a one component, ready-to-use solution for ELISA applications. A soluble blue-green reaction product is obtained when this substrate system is reacted with horseradish peroxidase.
Supplier:  TCI America
Description:   CAS Number: 21190-87-4
MDL Number: MFCD00093197
Molecular Formula: C6H4BrNO2
Molecular Weight: 202.01
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 189
MSDS SDS
Catalog Number: (75788-974)

Supplier:  Prosci
Description:   Interleukin-20 (IL-20) is a member of the IL-10 family of regulatory cytokines that includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. IL-20 exhibits approximately 28% amino acid identity with IL-10 and 76% amino acid identity with mouse IL-20. There are two heterodimeric receptor complexes for IL-20. The first is composed of IL-20 R alpha and IL-20 R beta . The second is composed of IL-22 R and IL-20 R beta . Whereas the IL-22 R/IL-20 R beta complex is shared with IL-24, the IL-20 R alpha/IL-20 R beta complex is shared with both IL-19 and IL-24. IL-20 has been shown to initiate transduction cascades involving STAT3 and stimulates the induction of pro-inflammatory genes including TNF- alpha and MCP-1. Initial functional studies using transgenic mice suggest that IL-20 has the ability to regulate skin development. The over-expression of both human and mouse forms of IL-20 results in keratinocyte hyper-proliferation, abnormal epidermal differentiation, and neonatal lethality. In humans, IL-20 and its receptors are up-regulated in psoriatic skin, and polymorphisms in the IL-20 gene have been associated with plaque-type psoriasis. IL-20 may also have a role in hematopoiesis. It enhances the proliferation of multi-potential progenitors in vitro and increases their numbers and cell cycling status in IL-20 transgenic mice. IL-20 is also shown to suppress COX-2 and PGE2 and acts as an inhibitor of angiogenesis in model systems.
Catalog Number: (TCO0274-001G)

Supplier:  TCI America
Description:   CAS Number: 54567-92-9
MDL Number: MFCD01861293
Molecular Formula: C8H16Cl2O3
Molecular Weight: 231.11
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 195
Specific Gravity (20/20): 1.13
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  AMBEED, INC
Description:   5-Bromopentyl acetate 95%

Supplier:  Bioss
Description:   The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF185 (ring finger protein 185), also known as FLJ38628, is a 192 amino acid multi-pass membrane protein containing one RING-type zinc finger. Two RNF185 isoforms exist as a result of alternative splicing, and the gene encoding RNF185 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number: (89520-614)

Supplier:  Abgent
Description:   Polyclonal antibody, Isotype: Rabbit Ig, Species reactivity: Mouse, Gene ID: 11480, Target/Specificity: This Mouse Acvr2a antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-49 amino acids from the N-terminal region of mouse Acvr2a.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-15 - 0  of 74,817