Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-[1,1\\\\\\\'-Biphenyl]-4-ylacrylic+acid


145,862  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"145862"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   4-(trans-4-Propylcyclohexyl)phenyl trans-4-(trans-4-propylcyclohexyl)cyclohexanecarboxylate 97%
Supplier:  AMBEED, INC
Description:   3-Chloro-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile 98%

Supplier:  Anaspec Inc
Description:   This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyteâ„¢ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyteâ„¢ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyteâ„¢ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   Methyl 4-(Aminomethyl)Benzoate Hydrochloride, MF=C9H12Clno2 MW=201.65 CAS: 6232-11-7 MDL=MFCD00182671 5G
Supplier:  Thermo Scientific Chemicals
Description:   N-Boc-1,2,5,6-tetrahydropyridine-4-boronic acid pinacol ester, 95%
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C8H6Clno4 MW=215.59 Cas=13324-11-3 MDL=MFCD00017013 5G
MSDS SDS
Supplier:  MilliporeSigma
Description:   Meets ACS Specifications
MSDS SDS
Catalog Number: (10114-730)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: PAH antibody was raised against an 11 amino acid synthetic peptide near the internal region of PAH; Applications: ELISA,Western blotting
Supplier:  Ricca Chemical
Description:   Eriochrome Black T USP Test Solution (TS)
MSDS SDS
Small Business Enterprise
Catalog Number: (10113-152)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: PGLYRP1 antibody was raised against an 11 amino acid synthetic peptide near the C-Terminus of PGLYRP1, Tested Applications: ELISA, WB, IHC
Catalog Number: (10114-764)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: PTCHD1 antibody was raised against an 11 amino acid synthetic peptide near the internal region of PTCHD1; Applications: ELISA,Western blotting
Catalog Number: (10116-240)

Supplier:  Prosci
Description:   Polyclonal antibody LNK Host: Goat Target Species: human immunogen: LNK antibody was raised against an 11 amino acid synthetic peptide near the N-Terminus of LNK. Application: ELISA, WB, IF
Catalog Number: (10116-168)

Supplier:  Prosci
Description:   Polyclonal antibody KCC1 Host: Goat Target Species: human immunogen: KCC1 antibody was raised against an 11 amino acid synthetic peptide near the internal region of KCC1. Application: ELISA, WB
Catalog Number: (10072-832)

Supplier:  Prosci
Description:   IL-11 is a multifunctional cytokine produced by stromal cells such as fibroblasts, epithelial cells and osteoclasts. It is expressed in a wide variety of tissues including thymus, lung, bone, connective tissue and central nervous system. IL-11 plays an important regulatory role in hematopoiesis by stimulating growth of myeloid, erythroid and megakaryocyte progenitor cells. It also regulates bone metabolism, inhibits production of proinflammatory cytokines and protects against gastromucosal injury. Recombinant Human IL-11 is a 19.1 kDa protein consisting of 179 amino acid residues.
Supplier:  AMBEED, INC
Description:   3-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)-1-[tris(1-methylethyl)silyl]-1H-pyrrole, Purity: 98%, CAS Number: 365564-11-0, Appearance: Solid, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 250MG
Supplier:  MP Biomedicals
Description:   PIPES is frequently used as a buffering agent in biochemistry; it is an ethanesulfonic acid buffer developed by Good et al. in the 1960s. PIPES has a pKa near the physiological pH which makes it useful in cell culture work.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,425 - 3,440  of 145,862