Text Search >
3-Amino-5-methylpyridine-2-carboxylic+acid+amide
Print…
You Searched For:
173,851 results were found
3-Amino-5-methylpyridine-2-carboxylic+acid+amide
Catalog Number:
(103006-660)
Supplier:
Anaspec Inc
Description:
This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2 MW: 1773 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
Anaspec Inc
Description:
This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 MW: 3357.9 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
Bachem Americas
Description:
Allylglycine-containing peptides may be cleaved selectively at the amide bond between allylglycine and the subsequent amino acid with iodine. The lateral double bond allows selective modifications of a peptide e.g. via metathesis. Replacing cysteine residues by allylglycine allows to obtain carba-analogs of disulfide-bridged peptides.Educt for obtaining Fmoc-prenylglycine.
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Biuret 97%, Extra Pure
Supplier:
Bachem Americas
Description:
Exendin-4 (exenatide), originally isolated from Heloderma suspectum venom, differs from exendin-3 by only 2 N-terminal amino acid substitutions. This polypeptide causes an increase in acinar cAMP without stimulating amylase release. Exendin-4 and glucagon-like peptide 1 (7-36) amide bind with similar affinity to the glucagon-like peptide 1 receptor. Moreover, exendin-4 is also considered for clinical use in the treatment of type 2 diabetes.
Catalog Number:
(103007-252)
Supplier:
Anaspec Inc
Description:
This peptide is a C-terminal surface sorting signal with a conserved LPXTG motif, labeled with the Dabcyl/Edans FRET pair. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Surface proteins of Staphylococcus aureus are anchored to the bacterial cell wall by a mechanism requiring this C-terminal sorting signal. Cell wall sorting is the covalent attachment of surface proteins to the peptidoglycan via a C-terminal sorting signal that contains a consensus LPXTG sequence. Cleavage of this FRET substrate by sortase reveals the fluorescent signal that may be measured to study sortase activity. Inhibition of the sortase activity is a potential way of treatment of the staphylococcal infection. The LPXTG motif is conserved in more than 100 surface proteins of Gram-positive pathogens.
Sequence:Dabcyl-QALPETGEE-Edans MW:1472.6 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(IC15670980)
Supplier:
MP Biomedicals
Description:
Sulfamethazine is an antibiotic used to clinically treat bronchitis, prostatitis and urinary tract infections. It is used in disposition and depletion kinetic studies. It is used to develop detection techniques for quantification in fluids such as cows’ milk, honey and swine urine.
Sulfamethazine is an antimicrobial sulfur drug that blocks the synthesis of dihydrofolic acid by inhibiting the enzyme dihydropteroate synthase. Sulfamethazine is a competitive inhibitor of bacterial para-aminobenzoic acid (PABA), which is required for bacterial synthesis of folic acid. It induces CYP3A4 expression and is acetylated by N-acetyltransferase. It exhibits sex dependent pharmacokinetics, metabolized by the male specific isoform CYP2C11. Sulfamethazine is bacteriostatic.
Catalog Number:
(TCB3228-1G)
Supplier:
TCI America
Description:
CAS Number: 108-19-0
MDL Number: MFCD00007946 Molecular Formula: C2H5N3O2 Molecular Weight: 103.08 Purity/Analysis Method: >99.0% (N) Form: Crystal Melting point (°C): 193
Catalog Number:
(103007-796)
Supplier:
Anaspec Inc
Description:
This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2 MW:2016.4 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103007-400)
Supplier:
Anaspec Inc
Description:
This octameric peptide is amino acids 257 to 264 amidated fragment of ovalbumin (OVA), a class I (Kb)-restricted peptide epitope of OVA, presented by the class I MHC molecule, H-2Kb.
Sequence: SIINFEKL-NH2 MW: 962.2 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Catalog Number:
(103008-470)
Supplier:
Anaspec Inc
Description:
This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Catalog Number:
(103280-126)
Supplier:
Novus Biologicals
Description:
The AMID Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMID. This antibody reacts with human. The AMID Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(103008-472)
Supplier:
Anaspec Inc
Description:
This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13) MW:2155.7 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
Bachem Americas
Description:
Galanin-like peptide (GALP), first isolated from the porcine hypothalamus and subsequently also identified in rats and humans, is a 60 amino acid neuropeptide that unlike galanin, has a non-amidated C-terminus. Its amino acid residues (9-21) are identical to the biologically active N-terminal (1-13) fragment of galanin. In contrast to galanin which is relatively non-selective, receptor binding studies revealed that GALP had a high affinity for the galanin receptor 2 (GALR2) and a lower affinity for the GALR1 receptor. Furthermore, it could be demonstrated that GALP stimulates food intake with a ten fold higher orexigenic activity than galanin and may also affect emotional state in the CNS.
Catalog Number:
(103008-238)
Supplier:
Anaspec Inc
Description:
This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7) MW:3793.4 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Supplier:
AMBEED, INC
Description:
N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-2-phenylglycine 97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
