Text Search >
4,4'-Diaminostilbene-2,2'-disulfonic+Acid
Print…
You Searched For:
160,201 results were found
4,4'-Diaminostilbene-2,2'-disulfonic+Acid
Catalog Number:
(RL605-4604)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Goat IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL601-4604)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Bovine IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL208-4307)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Horse IgM in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(76069-310)
Supplier:
Prosci
Description:
For WB starting dilution is: 1:1000
Catalog Number:
(10072-538)
Supplier:
Prosci
Description:
VCAM is a 110 kDa cell surface integral membrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. The primary function of VCAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. VCAM-1 may play a vital role in the development several diseases, including atherosclerosis and rheumatoid arthritis. The human VCAM-1 gene codes for a 715 amino acid transmembrane glycoprotein containing a 19 amino acid cytoplasmic domain, a 22 amino acid transmembrane domain, and a 674 amino acid extracellular domain. Recombinant human VCAM-1 is a kDa glycoprotein comprising the extracellular domain (674 amino acid residues) of VCAM-1. Monomeric glycosylated VCAM-1 migrates at an apparent molecular weight of approximately 74.1kDa by SDS-PAGE analysis under reducing conditions.
Catalog Number:
(RL100-101-238)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Glutamine Synthetase (Microbial) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(TS40118-0250)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Methyl blue, pure, certified
Supplier:
TCI America
Description:
CAS Number: 399-76-8
MDL Number: MFCD00005612
Molecular Formula: C9H6FNO2
Molecular Weight: 179.15
Purity/Analysis Method: <gt/>98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 249
Catalog Number:
(TCD2280-025ML)
Supplier:
TCI America
Description:
CAS Number: 81749-14-6
MDL Number: MFCD00191422 Molecular Formula: C15H28O4 Molecular Weight: 272.39 Purity/Analysis Method: >98.0% (GC) Form: Clear Liquid Boiling point (°C): 102 Specific Gravity (20/20): 0.96
Supplier:
MP Biomedicals
Description:
Calcein is an indicator for the determination of calcium by titration with EDTA. The excitation wavelength and emission wavelength are 495/515 nm.
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(103680-190)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mature form of human CCL15 (Q16663-1) (Gln 22-Ile 113) was expressed, with a polyhistide tag at the C-terminus.
Catalog Number:
(101784-014)
Catalog Number:
(10670-278)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(IC15264325)
Catalog Number:
(10667-342)
Supplier:
Bioss
Description:
Members of the BAGE gene family encode antigens that are recognized by cytotoxic T lymphocytes and are also known as CT (cancer/testis) antigens. Generated by juxtacentromeric shuffling of the MLL3 gene, the ancestral BAGE gene was expanded by acrocentric exchanges and/or juxtacentromeric movements.Generally, BAGE proteins are silent in all normal tissues with the exception of testis. BAGE2 and BAGE 3 (B melanoma antigen 2 and 3, respectively), also known as Cancer/testis antigen 2.2 and 2.3 (respectively), are 109 amino acid secreted proteins that are expressed in 22% of melanomas, lung and bladder carcinomas, and are also expressed in normal testis tissue. Like the genes encoding MAGE proteins, BAGE genes are most likely silenced by DNA methylation and/or chromatin compaction in normal tissues other than testis.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
