Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Amino-3-bromobenzoic+acid


163,518  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163518"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10113-098)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: IFNAR2 antibody was raised against a 13 amino acid synthetic peptide near the internal region of IFNAR2, Application: ELISA
Supplier:  TCI America
Description:   3-(4-Pyridyl)-L-alanine Dihydrochloride, Purity: >96.0%(HPLC)(N), Cas number: 178933-04-5, Molecular Formula: C8H10N2O2.2HCl, Molecular Weight: 239.10, Appearance: White - Slightly pale reddish yellow solid crystal powder, Size: 5G
MSDS SDS
Supplier:  PeproTech, Inc.
Description:   IL-17F, a member of the IL-17 family of structurally related cytokines, has been shown to stimulate the proliferation and activation of T-cells and PBMCs. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. The mature human IL-17F is a homodimeric protein with a total weight of 30.1 kDa, consisting of two 133 amino acid residue chains.
Catalog Number: (10117-064)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Immunogen: RASSF4 antibody was raised against a 12 amino acid synthetic peptide near the internal region of RASSF4; Application: ELISA
Catalog Number: (10112-866)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: SUV39H2 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of SUV39H2, Application: ELISA, ChIP
Catalog Number: (10117-238)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Immunogen: ABHD6 antibody was raised against a 14 amino acid synthetic peptide near the internal region of ABHD6; Application: ELISA
Catalog Number: (10117-254)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Immunogen: ARID3C antibody was raised against a 13 amino acid synthetic peptide near the internal region of ARID3C; Application: ELISA

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (10112-352)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: AGRP antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of AGRP, Application: ELISA
Supplier:  PeproTech, Inc.
Description:   SCGF-α and -β are hematopoietic growth factors that exert their activity at early stages of hematopoiesis. The SCGFs are non-glycosylated species-specific cytokines that can support growth of primitive hematopoietic cells, and, in combination with EPO or GM-CSF, promote proliferation of erythroid or myeloid progenitors, respectively. Recombinant Human SCGF-β is a 25.0 kDa polypeptide containing 227 amino acid residues.
Catalog Number: (10112-150)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: BDH2 antibody was raised against a 12 amino acid synthetic peptide near the internal region of BDH2, Application: ELISA, WB
Catalog Number: (10112-366)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Rat, Immunogen: AKAP10 antibody was raised against a 13 amino acid synthetic peptide near the internal region of AKAP10, Application: ELISA, WB
Catalog Number: (10113-038)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: CHRNB4 antibody was raised against a 15 amino acid synthetic peptide near the internal region of CHRNB4, Application: ELISA, WB
Catalog Number: (10114-510)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: UHMK1 antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus (near) of UHMK1 (near); Applications: ELISA,Western blotting
Catalog Number: (10117-332)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: NAT2 antibody was raised against a 14 amino acid synthetic peptide near the internal region of NAT2; Application: ELISA
Catalog Number: (10116-930)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: APOBEC4 antibody was raised against a 12 amino acid synthetic peptide near the internal region of APOBEC4; Application: ELISA
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,129 - 8,144  of 163,518