Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163518"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Anaspec Inc
Description:   This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Biotium
Description:   Membrane-permeant AM ester form of Fluo-3 that can be loaded into cells via incubation. Fluo-3 AM ester itself does not bind Ca2 , but it is readily hydrolyzed to Fluo-3 by endogenous esterases once the dye is inside the cells. An important application of Fluo-3 AM ester is its use in high throughput drug screening.
Supplier:  LGC STANDARDS
Description:   Perfluorononanoic acid 13C9 50 µg/mL in Methanol:Water, Dr. Ehrenstorfer, LGC Standards
New Product

Supplier:  Prosci
Description:   CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NT-1/ BSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.5 kDa protein consisting of 201 amino acid residues.
Supplier:  Shenandoah Biotechnology
Description:   Interferon-alpha 2b (IFN-α2b) is a type I interferon made by leukocytes during viral infection. The JAK-STAT pathway mediates the antiviral and anti-cell proliferation activities of IFN-α2b. IFN-α proteins are widely used as standard treatments during antiviral and antineoplastic therapies. The IFN-α2b variant differs from IFN-α2a by one amino acid.
Supplier:  BeanTown Chemical
Description:   CAS: 60-00-4; EC No: 200-449-4; MDL No: MFCD00003541; RTECS: AH4025000 Powder; Molecular Formula: C10H16N2O8; MW: 292.24 Melting Point: 250° (decomposes)
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 71-00-1; EC No: 200-745-3; MDL No: MFCD00064315; RTECS: MS3070000 Solid; Molecular Formula: C6H9N3O2; MW: 155.15 Melting Point: 282° (decomposes) Optical Rotation: [α]20/D -39±1°, c = 2% in water
MSDS SDS
Supplier:  Bachem Americas
Description:   Thymosin β₄ is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β₄ may contribute to physiological processes such as angiogenesis, wound healing, and regulation of inflammation. Additionally to its numerous functions thymosin β₄ might also be of therapeutic value in the setting of acute myocardial damage.
Supplier:  AMBEED, INC
Description:   1-Cbz-3-Aminoazetidine, Purity: 98%, CAS Number: 112257-20-2, Appearance: Solid or Semi-solid or liquid or lump, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 25g

Supplier:  AAT BIOQUEST INC
Description:   Calcium measurement is critical for numerous biological investigations.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  AMBEED, INC
Description:   4-(N-(4-Cyclohexylbenzyl)-2-((2,3,4,5,6-pentafluoro-N-methylphenyl)sulfonamido)acetamido)benzoic acid, Purity: 98+%, CAS Number: 1456632-40-8, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8 C, Size: 1mg

Supplier:  Hardy Diagnostics
Description:   For the differentiation of gram negative enteric bacilli based on the decarboxylation reaction of amino acids.
Product available on GSA Advantage®
Catalog Number: (10234-132)

Supplier:  Bioss
Description:   C Peptide is part of the molecule of Proinsulin, that consists of three parts: C Peptide and two long strands of amino acids (called the alpha and beta chains) that later become linked together to form the insulin molecule. From every molecule of proinsulin, one molecule of insulin plus one molecule of C Peptide are produced. C peptide is released into the blood stream in equal amounts to insulin. A test of C peptide levels will show how much insulin the body is making. Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Catalog Number: (10114-506)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: TERF2IP antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of TERF2IP; Applications: ELISA,Western blotting
Catalog Number: (10113-936)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: NUAK1 antibody was raised against a 15 amino acid synthetic peptide near the internal region of NUAK1, Tested Applications: ELISA
Catalog Number: (10113-224)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: ARG1 antibody was raised against a 15 amino acid synthetic peptide near the C-Terminus of ARG1, Tested Applications: ELISA, WB
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,129 - 2,144  of 163,518