Text Search >
4-Amino-3-bromobenzoic+acid
Print…
You Searched For:
164,474 results were found
4-Amino-3-bromobenzoic+acid
Catalog Number:
(103009-738)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (275-305) is a 31-amino acid long peptide derived from the Repeat 2 domain.
Sequence:VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS MW:3263.77 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103009-746)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN MW:3467.86 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103009-734)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (244-274) is a 31-amino acid long peptide derived from the Repeat 1 domain.
Sequence:Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK MW:3299.83 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
REVACC INC
Description:
A recombinant form of the receptor binding domain (RBD) with amino acids 319 to 541) of the spike (S) glycoprotein gene from SARS-CoV-2 bearing mutations identified in variant of Omicron BA.4/5, was produced by insect cells, followed by purification.
Supplier:
Spectrum Chemicals
Description:
L-Glutamine, FCC - The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Catalog Number:
(89143-942)
Supplier:
Enzo Life Sciences
Description:
Isolated from stimulated human neutrophils. The secreted protein consists of 184 amino acids, six disulfide bonds and two glycosylation sites containing N-linked oligosaccharides.
Supplier:
REVACC INC
Description:
A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2), Wuhan-Hu-1 (GenBank: MN908947) was produced by human embryonic kidney HEK293F cells, followed by purification.
Catalog Number:
(76193-608)
Supplier:
Prosci
Description:
Acid phosphatases are a broad family of enzymes that differ widely in their amino acid length and homology, molecular weight and tissue of origin. They function to remove phosphate groups (or dephosphorylate) from proteins and perform best under acidic conditions. Disease states are sometimes characterized by abnormally high or low levels of Acid Phosphatase, leading to them being used as serological and histological disease markers. Prostatic Acid Phosphatase (PAP) was initially used as a prostate cancer marker but was later replaced with Prostate Serum Antigen (PSA), a more sensitive early stage cancer marker.
Supplier:
AMBEED, INC
Description:
Fmoc-L-4-carbamoylphe ≥98%
Catalog Number:
(103007-440)
Supplier:
Anaspec Inc
Description:
This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA MW:2272.5 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10285-088)
Supplier:
Bioss
Description:
Cytochrome P450 proteins are heme-thiolate monooxygenases that mediate NADPH-dependent electron transport and function to oxidize a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Specifically, Cytochrome P450s are responsible for metabolizing arachidonic acid to hydroxyeicosatetraenoic acid (a regulator of blood pressure) and epoxyeicosatrienoic acid (a molecule involved in signaling events). CYP20A1 (cytochrome P450, family 20, subfamily A, polypeptide 1), also known as CYP-M, is a 462 amino acid single-pass membrane protein that belongs to the cytochrome P450 family. CYP20A1 is thought to carry its own oxygen as it lacks a conserved I-helix motif and one amino acid of its conserved heme binding site.
Catalog Number:
(101215-404)
Supplier:
BioVendor
Description:
Resistin, a product of the RSTN gene, is a peptide hormone belonging to the class of cysteine-rich secreted proteins which is termed the RELM family, and is also described as ADSF (Adipose Tissue-Specific Secretory Factor) and FIZZ3 (Found in Inflammatory Zone). Human resistin contains 108 amino acids as a prepeptide, and its hydrofobic signal peptide is cleaved before its secretion. Resistin circulates in human blood as a dimeric protein consisting of two 92 amino acid polypeptides, which are disulfide-linked via Cys26. Resistin may be an important link between obesity and insulin resistance. Mouse resistin, specifically produced and secreted by adipocyte, acts on skeletal muscle myocytes, hepatocytes and adipocytes themselves so that it reduces their sensitivity to insulin.
Supplier:
MilliporeSigma
Description:
(Gly). White crystalline solid. Purity: >99% by assay. Soluble in H2O. RTECS MB7600000, CAS 56-40-6, M.W. 75.1. WARNING! May be carcinogenic/teratogenic.
Catalog Number:
(10450-490)
Supplier:
Bioss
Description:
Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
Supplier:
AMBEED, INC
Description:
3-[N-Tris(hydroxymethyl)methylamino]-2-hydroxypropanesulfonic Acid, Purity: 99%, CAS Number: 68399-81-5, Appearance: Form: Crystal - PowderColour: White - Almost white, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100G
Supplier:
Matrix Scientific
Description:
MF=C11H20N2O2 MW=212.29 Cas=1211586-09-2 ,500Mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
