Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Ytterbium(III)+trifluoromethanesulphonate+hydrate


10,923  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"10923"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 15057-11-1
MDL Number: MFCD06797048
Molecular Formula: C7H14O3
Molecular Weight: 146.19
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 71
MSDS SDS
Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The MPC-11 monoclonal antibody is expressed by a cell line adapted from the Merwin Plasmacytoma-11, and has unknown specificity. The MPC-11 line was obtained by intraperitoneal implantation into a BALB/c Mouseof a Millipore diffusion chamber and is used as an Isotype Control for Mouse IgG2b antibodies.
Supplier:  AMBEED, INC
Description:   2-(Benzyloxy)benzamide, Purity: 95+%, CAS Number: 29579-11-1, Appearance: White to off-white solid, Storage: Sealed in dry, Room Temperature, Size: 5g
Supplier:  Enzo Life Sciences
Description:   Antitumor agent.

Supplier:  Novus Biologicals
Description:   The Myosin heavy chain 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin heavy chain 11. This antibody reacts with human. The Myosin heavy chain 11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (TCA1542-005ML)

Supplier:  TCI America
Description:   CAS Number: 10500-11-5
MDL Number: MFCD02093427
Molecular Formula: C7H12O2
Molecular Weight: 128.17
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 132
Specific Gravity (20/20): 0.90
MSDS SDS
Supplier:  AMBEED, INC
Description:   2-Bromo-3-(trifluoromethoxy)pyridine, Purity: 95%, CAS Number: 1206978-11-1, Appearance: Colorless to Yellow Liquid, Storage: Sealed in dry, 2-8C, Size: 100MG
Supplier:  AMBEED, INC
Description:   5,6-Dibromopyridin-2-amine, Purity: 97%, CAS number: 89284-11-7, Appearance: White to Yellow Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100MG
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 062937-500MG , MDL Number: MFCD01579587
Supplier:  AMBEED, INC
Description:   6-Chloro-4-hydroxy-2-methyl-2H-thieno[2,3-e]-1,2-thiazine-3-carboxylic acid methyl ester 1,1-dioxide, Purity: 95%, CAS Number: 70415-50-8, Appearance: Almost white to light yellow or light yellow-greenish powder, Storage: Inert atmosphere, 2-8C, Size: 5G
Supplier:  APOLLO SCIENTIFIC
Description:   2-Fluoro-5-methyl-4-(trifluoromethyl)phenylacetonitrile 98%

Supplier:  Novus Biologicals
Description:   Mast Cell Protease-11/Prss34 Polyclonal Antibody, Host: Goat, Conjugate: Biotin, Species: Mouse, Isotype: IgG, Immunogen: Mouse myeloma cell line NS0-derived recombinant mouse Mast Cell Protease-11/Prss34, Synonym: MCP-11, Application: WB, Size: 50ug
Supplier:  Strem Chemicals Inc
Description:   BINAP

Supplier:  Anaspec Inc
Description:   This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AFG BIOSCIENCE LLC
Description:   Human Interleukin-11 Receptor Subunit α (IL-11Rα) ELISA Kit, AFG Bioscience
Supplier:  Novus Biologicals
Description:   The hydroxysteroid (17-beta) dehydrogenase 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to hydroxysteroid (17-beta) dehydrogenase 11. This antibody reacts with human. The hydroxysteroid (17-beta) dehydrogenase 11 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,521 - 3,536  of 10,923