Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Methyl+2-amino-5-(dimethylphosphoryl)benzoate


26,381  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"26381"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   (4S,4'S,5R,5'R)-2,2'-(Cyclohexane-1,1-diyl)bis(4,5-diphenyl-4,5-dihydrooxazole) ≥97%, ee 99%
New Product
Catalog Number: (103005-822)

Supplier:  Anaspec Inc
Description:   Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Genetex
Description:   Mouse monoclonal antibody [F8-11-13] to CD45RA
Supplier:  AMBEED, INC
Description:   4'-Methylbiphenyl-3-carboxylic acid 98%

Supplier:  Novus Biologicals
Description:   The Myosin heavy chain 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin heavy chain 11. This antibody reacts with human. The Myosin heavy chain 11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  AOB CHEM USA
Description:   N-(2-Bromo-4-isopropylphenyl)-2,2,2-trifluoroacetamide ≥97%
Supplier:  Thermo Scientific Chemicals
Description:   Grade: tech. ca 75% w/w aq. soln. . Melting Point C. Boiling Point C: NA. C6H6O3S. 98-11-3. CORROSIVE HARMFUL
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043966-1G , MDL Number: MFCD04117797
Supplier:  Bioss
Description:   Produced by macrophages, IFN alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Supplier:  Bioss
Description:   Produced by macrophages, IFN alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Supplier:  AMBEED, INC
Description:   Biphenyl-2-carboxaldehyde 97%
Supplier:  AMBEED, INC
Description:   4-Phenylbenzoic acid 98%
Supplier:  AMBEED, INC
Description:   4-(4-((4'-Chloro-4,4-dimethyl-3,4,5,6-tetrahydro-[1,1'-biphenyl]-2-yl)methyl)piperazin-1-yl)benzoic acid, Purity: 95%, CAS Number: 1044598-91-5, Appearance: White to off-white to light red or pale-yellow powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 100MG

Supplier:  Rockland Immunochemical
Description:   Human Eotaxin AccuSignal ELISA Kit
Supplier:  Matrix Scientific
MSDS SDS
Supplier:  AMBEED, INC
Description:   Sodium (3-amino-1-hydroxypropane-1,1-diyl)bis(hydrogen phosphonate), Purity: 98% (contains H2O), CAS Number: 57248-88-1, Appearance: Form: Crystal - Powder/Colour: White - Almost white, Storage: Inert atmosphere, 2-8 C, Size: 25g
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,369 - 6,384  of 26,381
Prev